BLASTX nr result
ID: Wisteria21_contig00038977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038977 (285 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN02518.1| Putative basic helix-loop-helix protein [Glycine ... 58 3e-06 >gb|KHN02518.1| Putative basic helix-loop-helix protein [Glycine soja] Length = 889 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 280 ETYTDWISCGPLFRYCNPRALCIHNNWLILPN 185 E YTDWISCG LF+YCNPRA CIH N L+L N Sbjct: 847 EMYTDWISCGRLFKYCNPRAPCIHINLLVLGN 878