BLASTX nr result
ID: Wisteria21_contig00038941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038941 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150645.1| hypothetical protein PHAVU_005G169800g [Phas... 58 3e-06 >ref|XP_007150645.1| hypothetical protein PHAVU_005G169800g [Phaseolus vulgaris] gi|561023909|gb|ESW22639.1| hypothetical protein PHAVU_005G169800g [Phaseolus vulgaris] Length = 102 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -3 Query: 387 SCHHAY-NSAMVCLGALFGCRRSNSIVGYLLSALVSISI 274 S H AY N MVCLGALFGC+RSNS V YLLSALVS+SI Sbjct: 24 SIHIAYSNYPMVCLGALFGCKRSNSFVAYLLSALVSVSI 62