BLASTX nr result
ID: Wisteria21_contig00038789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038789 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134605.1| hypothetical protein PHAVU_010G060800g [Phas... 92 1e-16 gb|KHN40717.1| Lectin-domain containing receptor kinase VI.3 [Gl... 91 3e-16 gb|KHN28870.1| Lectin-domain containing receptor kinase VI.3 [Gl... 91 3e-16 ref|XP_003551569.1| PREDICTED: lectin-domain containing receptor... 91 3e-16 ref|XP_003522051.1| PREDICTED: probable L-type lectin-domain con... 91 3e-16 gb|KRH49436.1| hypothetical protein GLYMA_07G154100 [Glycine max] 90 8e-16 gb|KHN23036.1| Lectin-domain containing receptor kinase VI.3 [Gl... 90 8e-16 ref|XP_003530300.2| PREDICTED: probable L-type lectin-domain con... 90 8e-16 ref|XP_014511779.1| PREDICTED: lectin-domain containing receptor... 88 3e-15 gb|KOM58011.1| hypothetical protein LR48_Vigan11g104400 [Vigna a... 87 4e-15 ref|XP_007140223.1| hypothetical protein PHAVU_008G094500g [Phas... 86 1e-14 ref|XP_014490660.1| PREDICTED: lectin-domain containing receptor... 81 3e-13 gb|KOM37444.1| hypothetical protein LR48_Vigan03g082600 [Vigna a... 81 4e-13 gb|KDO56747.1| hypothetical protein CISIN_1g035655mg [Citrus sin... 58 2e-06 ref|XP_006429466.1| hypothetical protein CICLE_v10013896mg [Citr... 58 2e-06 ref|XP_011466452.1| PREDICTED: lectin-domain containing receptor... 58 3e-06 ref|XP_008359802.1| PREDICTED: lectin-domain containing receptor... 57 7e-06 ref|XP_007026606.1| Concanavalin A-like lectin protein kinase fa... 57 7e-06 ref|XP_009376415.1| PREDICTED: lectin-domain containing receptor... 56 9e-06 >ref|XP_007134605.1| hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] gi|561007650|gb|ESW06599.1| hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] Length = 662 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/58 (74%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 EVELVLKLGLLCTQ+KA+YRP+++QVT+YLNFDDP PDI+ WR+YDS+S TSL F E Sbjct: 584 EVELVLKLGLLCTQNKAEYRPSIEQVTRYLNFDDPFPDISDWRYYDSQSSTTSLGFTE 641 >gb|KHN40717.1| Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 683 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 EVELVLKLGLLCTQH+ADYRP+MKQVT+YLNFDDPLPDIA W H S S R S FLE Sbjct: 598 EVELVLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGHDVSGSSRLSEGFLE 655 >gb|KHN28870.1| Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 677 Score = 91.3 bits (225), Expect = 3e-16 Identities = 43/58 (74%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 E+ELVLKLGLLC+Q+KA+YRP+MKQV +YLNFDD LPDI+ WR+YDS+S SLSFLE Sbjct: 592 EMELVLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYDSQSSTNSLSFLE 649 >ref|XP_003551569.1| PREDICTED: lectin-domain containing receptor kinase VI.4-like [Glycine max] gi|947050777|gb|KRH00306.1| hypothetical protein GLYMA_18G205000 [Glycine max] Length = 683 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 EVELVLKLGLLCTQH+ADYRP+MKQVT+YLNFDDPLPDIA W H S S R S FLE Sbjct: 598 EVELVLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGHDVSGSSRLSEGFLE 655 >ref|XP_003522051.1| PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1-like [Glycine max] gi|947117386|gb|KRH65635.1| hypothetical protein GLYMA_03G051100 [Glycine max] Length = 677 Score = 91.3 bits (225), Expect = 3e-16 Identities = 43/58 (74%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 E+ELVLKLGLLC+Q+KA+YRP+MKQV +YLNFDD LPDI+ WR+YDS+S SLSFLE Sbjct: 592 EMELVLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYDSQSSTNSLSFLE 649 >gb|KRH49436.1| hypothetical protein GLYMA_07G154100 [Glycine max] Length = 681 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/58 (75%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 E+ELVLKLGLLCTQH+ADYRPTMKQVT+YLNFD+PLPDI W H S S R S FLE Sbjct: 591 EIELVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGHGVSGSSRLSSGFLE 648 >gb|KHN23036.1| Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 625 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/58 (75%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 E+ELVLKLGLLCTQH+ADYRPTMKQVT+YLNFD+PLPDI W H S S R S FLE Sbjct: 535 EIELVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGHGVSGSSRLSSGFLE 592 >ref|XP_003530300.2| PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1-like [Glycine max] Length = 696 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/58 (75%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 E+ELVLKLGLLCTQH+ADYRPTMKQVT+YLNFD+PLPDI W H S S R S FLE Sbjct: 606 EIELVLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGHGVSGSSRLSSGFLE 663 >ref|XP_014511779.1| PREDICTED: lectin-domain containing receptor kinase VI.4-like [Vigna radiata var. radiata] Length = 668 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/58 (72%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 EVELVLKLGLLC+Q+KA+YRP+++QVT+YLNFDDP PDI+ R+YDS+S TSL FLE Sbjct: 584 EVELVLKLGLLCSQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYDSQSSTTSLGFLE 641 >gb|KOM58011.1| hypothetical protein LR48_Vigan11g104400 [Vigna angularis] Length = 667 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/58 (72%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTSLSFLE 172 EVELVLKLGLLC Q+KA+YRP+++QVT+YLNFDDP PDI+ R+YDS+S TSL FLE Sbjct: 583 EVELVLKLGLLCAQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYDSQSSTTSLGFLE 640 >ref|XP_007140223.1| hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] gi|561013356|gb|ESW12217.1| hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] Length = 673 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/59 (72%), Positives = 48/59 (81%), Gaps = 2/59 (3%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDS-ESRRTSLSFLE 172 EVELVLKLGLLC+QH+ DYRPTMKQVT+YLNFDDPLPD A W H+ S S R + FLE Sbjct: 587 EVELVLKLGLLCSQHRPDYRPTMKQVTRYLNFDDPLPDTADWGHFGSNSSSRMNSGFLE 645 >ref|XP_014490660.1| PREDICTED: lectin-domain containing receptor kinase VI.3-like [Vigna radiata var. radiata] Length = 683 Score = 81.3 bits (199), Expect = 3e-13 Identities = 42/61 (68%), Positives = 46/61 (75%), Gaps = 4/61 (6%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIAWRHY----DSESRRTSLSFL 169 EVELVLKLGLLCTQ ++DYRPTMKQVT+YLNFDDPLPDI Y S S R + FL Sbjct: 595 EVELVLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLPDIGDLGYGGSDSSSSSRMNSGFL 654 Query: 170 E 172 E Sbjct: 655 E 655 >gb|KOM37444.1| hypothetical protein LR48_Vigan03g082600 [Vigna angularis] Length = 677 Score = 80.9 bits (198), Expect = 4e-13 Identities = 41/59 (69%), Positives = 46/59 (77%), Gaps = 2/59 (3%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIAWRHY--DSESRRTSLSFLE 172 EVELVLKLGLLCTQ ++DYRPTMKQVT+YLNFDDPLPDI Y + S R + FLE Sbjct: 591 EVELVLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLPDIGDLGYGGSNSSSRMNSGFLE 649 >gb|KDO56747.1| hypothetical protein CISIN_1g035655mg [Citrus sinensis] Length = 670 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDI-AWRHYDSESRRTSLSFLE 172 E+ELVL+LGLLC+ KA+ RPTM+QV +YLN D+ LP I W DS+ + +LE Sbjct: 585 EMELVLQLGLLCSHQKAEARPTMRQVLRYLNGDELLPIIDNWSSLDSQRSEMNSRYLE 642 >ref|XP_006429466.1| hypothetical protein CICLE_v10013896mg [Citrus clementina] gi|568854983|ref|XP_006481092.1| PREDICTED: lectin-domain containing receptor kinase VI.3-like [Citrus sinensis] gi|557531523|gb|ESR42706.1| hypothetical protein CICLE_v10013896mg [Citrus clementina] Length = 686 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDI-AWRHYDSESRRTSLSFLE 172 E+ELVL+LGLLC+ KA+ RPTM+QV +YLN D+ LP I W DS+ + +LE Sbjct: 601 EMELVLQLGLLCSHQKAEARPTMRQVLRYLNGDELLPIIDNWSSLDSQRSEMNSRYLE 658 >ref|XP_011466452.1| PREDICTED: lectin-domain containing receptor kinase VI.3-like [Fragaria vesca subsp. vesca] Length = 675 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/49 (57%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDI-AWRHYDSES 145 E+ELVL+LGLLC+ K + RPTM+QV +YLN D+PLP + W +SES Sbjct: 590 EMELVLELGLLCSHFKPEARPTMRQVVRYLNGDEPLPHVDNWDLIESES 638 >ref|XP_008359802.1| PREDICTED: lectin-domain containing receptor kinase VI.3-like [Malus domestica] Length = 674 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDSESRRTS 157 E++LVL+LGLLCT +K + RPTM+QV +YLN D+ LP++ W D SRR S Sbjct: 589 EMKLVLELGLLCTHYKPEARPTMRQVVRYLNEDEQLPEVENWNLVD--SRRVS 639 >ref|XP_007026606.1| Concanavalin A-like lectin protein kinase family protein, putative [Theobroma cacao] gi|508715211|gb|EOY07108.1| Concanavalin A-like lectin protein kinase family protein, putative [Theobroma cacao] Length = 674 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDI-AWRHYDSESRRTSLSFLE 172 EV LVL LGLLC+ K + RP+M++V +YLN DDPLP I W +DS S FLE Sbjct: 591 EVRLVLLLGLLCSHPKPEVRPSMRKVMRYLNRDDPLPPIDYWESFDSRDELYS-KFLE 647 >ref|XP_009376415.1| PREDICTED: lectin-domain containing receptor kinase VI.3-like [Pyrus x bretschneideri] Length = 674 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/47 (55%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVELVLKLGLLCTQHKADYRPTMKQVTKYLNFDDPLPDIA-WRHYDS 139 E++LVL+LGLLCT +K + RPTM+QV +YLN +D LP++ W DS Sbjct: 588 EMKLVLELGLLCTHYKPEARPTMRQVVRYLNEEDQLPEVENWNLIDS 634