BLASTX nr result
ID: Wisteria21_contig00038704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038704 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10929.1| unnamed protein product [Coffea canephora] 59 2e-06 >emb|CDP10929.1| unnamed protein product [Coffea canephora] Length = 487 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 327 KIPMRYGRVDASGPEQCPEVGRLPGKNHISSGSYLVM 217 KIPM+YGRVD SGPEQCPE GRLPGK +S LV+ Sbjct: 181 KIPMKYGRVDVSGPEQCPEEGRLPGKMSVSIADLLVI 217