BLASTX nr result
ID: Wisteria21_contig00038559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038559 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM52167.1| hypothetical protein LR48_Vigan09g082600 [Vigna a... 64 4e-08 ref|XP_003530713.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_014490725.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_007146280.1| hypothetical protein PHAVU_006G027400g [Phas... 62 2e-07 gb|KOM50222.1| hypothetical protein LR48_Vigan08g104900 [Vigna a... 58 2e-06 ref|XP_003545819.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >gb|KOM52167.1| hypothetical protein LR48_Vigan09g082600 [Vigna angularis] Length = 705 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVEAQR 180 SH HLE VNK LSYLT HM+DESKPFIYHFDVE R Sbjct: 668 SHLHLESVNKCLSYLTGHMDDESKPFIYHFDVETLR 703 >ref|XP_003530713.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X1 [Glycine max] gi|571473832|ref|XP_006586046.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X2 [Glycine max] gi|571473834|ref|XP_006586047.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X3 [Glycine max] gi|571473836|ref|XP_006586048.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X4 [Glycine max] gi|947097398|gb|KRH45983.1| hypothetical protein GLYMA_08G304400 [Glycine max] Length = 705 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVEAQRFY 174 SH HLELV K LSYL+ HMEDESKPF YHFDVE R Y Sbjct: 668 SHLHLELVFKCLSYLSDHMEDESKPFTYHFDVETLRLY 705 >ref|XP_014490725.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Vigna radiata var. radiata] Length = 680 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVEAQ 183 SH HLE VNK LSYLT HM+DESKPFIYHFDVE + Sbjct: 640 SHLHLESVNKCLSYLTVHMDDESKPFIYHFDVETE 674 >ref|XP_007146280.1| hypothetical protein PHAVU_006G027400g [Phaseolus vulgaris] gi|561019503|gb|ESW18274.1| hypothetical protein PHAVU_006G027400g [Phaseolus vulgaris] Length = 701 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVE 189 SH HLELV K LSYLT HM+DESKPFIYHFDVE Sbjct: 668 SHLHLELVYKCLSYLTGHMDDESKPFIYHFDVE 700 >gb|KOM50222.1| hypothetical protein LR48_Vigan08g104900 [Vigna angularis] Length = 705 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVEAQR 180 SH HLE VNK LSYL HM+DESK FIYHFDVE R Sbjct: 668 SHLHLESVNKCLSYLIGHMDDESKRFIYHFDVETLR 703 >ref|XP_003545819.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X1 [Glycine max] gi|571520914|ref|XP_006598078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X2 [Glycine max] gi|571520917|ref|XP_006598079.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X3 [Glycine max] gi|571520921|ref|XP_006598080.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X4 [Glycine max] gi|571520925|ref|XP_006598081.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X5 [Glycine max] gi|571520929|ref|XP_006598082.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X6 [Glycine max] gi|571520932|ref|XP_006598083.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X7 [Glycine max] gi|947064045|gb|KRH13306.1| hypothetical protein GLYMA_15G229600 [Glycine max] Length = 705 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 287 SHYHLELVNKWLSYLTSHMEDESKPFIYHFDVEAQRFY 174 SH HLELV K LSYL+ HMEDESK F YH DVE R Y Sbjct: 668 SHLHLELVFKCLSYLSDHMEDESKSFTYHLDVETLRLY 705