BLASTX nr result
ID: Wisteria21_contig00038517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038517 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38150.1| WD repeat-containing protein 85 like [Glycine soja] 83 9e-14 gb|KRH37617.1| hypothetical protein GLYMA_09G077900 [Glycine max] 82 1e-13 ref|XP_003533811.1| PREDICTED: diphthamide biosynthesis protein ... 82 1e-13 gb|KRH44783.1| hypothetical protein GLYMA_08G230900 [Glycine max] 80 8e-13 gb|KHN47691.1| WD repeat-containing protein 85 like [Glycine soja] 79 2e-12 ref|XP_006598016.1| PREDICTED: diphthamide biosynthesis protein ... 79 2e-12 gb|ACU19363.1| unknown [Glycine max] 79 2e-12 ref|XP_012568702.1| PREDICTED: diphthine methyltransferase homol... 78 3e-12 gb|ACJ85139.1| unknown [Medicago truncatula] gi|388502704|gb|AFK... 75 1e-11 ref|XP_003617841.1| transducin/WD-like repeat-protein [Medicago ... 75 1e-11 ref|XP_014490815.1| PREDICTED: diphthine methyltransferase homol... 74 4e-11 ref|XP_007133479.1| hypothetical protein PHAVU_011G182000g [Phas... 61 4e-07 ref|XP_011079370.1| PREDICTED: diphthamide biosynthesis protein ... 56 9e-06 ref|XP_011079369.1| PREDICTED: diphthamide biosynthesis protein ... 56 9e-06 >gb|KHN38150.1| WD repeat-containing protein 85 like [Glycine soja] Length = 287 Score = 82.8 bits (203), Expect = 9e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH GG TKPLVATCSFYDKLVRVWRP NDI+L Sbjct: 248 ADWQKGEANHIGGNTKPLVATCSFYDKLVRVWRPGNDIVL 287 >gb|KRH37617.1| hypothetical protein GLYMA_09G077900 [Glycine max] Length = 285 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH GG TKPLVATCSFYDKLVRVWRP ND+IL Sbjct: 246 ADWQKGEANHIGGNTKPLVATCSFYDKLVRVWRPGNDLIL 285 >ref|XP_003533811.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoformX1 [Glycine max] gi|571476816|ref|XP_006587080.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X2 [Glycine max] gi|571476818|ref|XP_006587081.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X3 [Glycine max] gi|734422155|gb|KHN41512.1| WD repeat-containing protein 85 like [Glycine soja] gi|947088946|gb|KRH37611.1| hypothetical protein GLYMA_09G077900 [Glycine max] gi|947088947|gb|KRH37612.1| hypothetical protein GLYMA_09G077900 [Glycine max] gi|947088948|gb|KRH37613.1| hypothetical protein GLYMA_09G077900 [Glycine max] gi|947088949|gb|KRH37614.1| hypothetical protein GLYMA_09G077900 [Glycine max] gi|947088950|gb|KRH37615.1| hypothetical protein GLYMA_09G077900 [Glycine max] gi|947088951|gb|KRH37616.1| hypothetical protein GLYMA_09G077900 [Glycine max] Length = 344 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH GG TKPLVATCSFYDKLVRVWRP ND+IL Sbjct: 305 ADWQKGEANHIGGNTKPLVATCSFYDKLVRVWRPGNDLIL 344 >gb|KRH44783.1| hypothetical protein GLYMA_08G230900 [Glycine max] Length = 300 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQK EANH GG TKPLVATCSFYDKLVRVWRP NDI+L Sbjct: 261 ADWQKREANHIGGNTKPLVATCSFYDKLVRVWRPGNDIVL 300 >gb|KHN47691.1| WD repeat-containing protein 85 like [Glycine soja] Length = 344 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH G TKPLVATCSFYDKLVRVWRP ND IL Sbjct: 305 ADWQKGEANHIGENTKPLVATCSFYDKLVRVWRPGNDFIL 344 >ref|XP_006598016.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X1 [Glycine max] gi|571520562|ref|XP_006598017.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X2 [Glycine max] gi|571520566|ref|XP_006598018.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X3 [Glycine max] gi|571520570|ref|XP_006598019.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X4 [Glycine max] gi|571520573|ref|XP_006598020.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X5 [Glycine max] gi|947063875|gb|KRH13136.1| hypothetical protein GLYMA_15G218700 [Glycine max] gi|947063876|gb|KRH13137.1| hypothetical protein GLYMA_15G218700 [Glycine max] gi|947063877|gb|KRH13138.1| hypothetical protein GLYMA_15G218700 [Glycine max] gi|947063878|gb|KRH13139.1| hypothetical protein GLYMA_15G218700 [Glycine max] Length = 344 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH G TKPLVATCSFYDKLVRVWRP ND IL Sbjct: 305 ADWQKGEANHIGENTKPLVATCSFYDKLVRVWRPGNDFIL 344 >gb|ACU19363.1| unknown [Glycine max] Length = 344 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH G TKPLVATCSFYDKLVRVWRP ND IL Sbjct: 305 ADWQKGEANHIGENTKPLVATCSFYDKLVRVWRPGNDFIL 344 >ref|XP_012568702.1| PREDICTED: diphthine methyltransferase homolog [Cicer arietinum] Length = 346 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQKGEANH GR+KPLVATCSFYDKLVRVWRP NDI L Sbjct: 307 ADWQKGEANHIEGRSKPLVATCSFYDKLVRVWRPCNDITL 346 >gb|ACJ85139.1| unknown [Medicago truncatula] gi|388502704|gb|AFK39418.1| unknown [Medicago truncatula] Length = 348 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDI 99 ADWQKGEANHT G +KP+VATCSFYDKLVRVWRP NDI Sbjct: 307 ADWQKGEANHTKGSSKPVVATCSFYDKLVRVWRPCNDI 344 >ref|XP_003617841.1| transducin/WD-like repeat-protein [Medicago truncatula] gi|355519176|gb|AET00800.1| transducin/WD-like repeat-protein [Medicago truncatula] Length = 421 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDI 99 ADWQKGEANHT G +KP+VATCSFYDKLVRVWRP NDI Sbjct: 380 ADWQKGEANHTKGSSKPVVATCSFYDKLVRVWRPCNDI 417 >ref|XP_014490815.1| PREDICTED: diphthine methyltransferase homolog [Vigna radiata var. radiata] gi|951070585|ref|XP_014490816.1| PREDICTED: diphthine methyltransferase homolog [Vigna radiata var. radiata] Length = 346 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 209 DWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 DW KGEANH GG+TKPL+ATCSFYDK VRVWR NDIIL Sbjct: 308 DWHKGEANHLGGKTKPLMATCSFYDKHVRVWRSANDIIL 346 >ref|XP_007133479.1| hypothetical protein PHAVU_011G182000g [Phaseolus vulgaris] gi|561006479|gb|ESW05473.1| hypothetical protein PHAVU_011G182000g [Phaseolus vulgaris] Length = 341 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQK EANH KPLVATCSFYDK +RVWR NDIIL Sbjct: 307 ADWQKVEANH-----KPLVATCSFYDKHLRVWRSANDIIL 341 >ref|XP_011079370.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X2 [Sesamum indicum] Length = 351 Score = 56.2 bits (134), Expect = 9e-06 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQ+G+ + G + P++ATCSFYD+L+ VW PE D+ + Sbjct: 312 ADWQRGDVSVVGRKKSPVIATCSFYDRLLHVWTPEGDVFV 351 >ref|XP_011079369.1| PREDICTED: diphthamide biosynthesis protein 7 homolog isoform X1 [Sesamum indicum] Length = 361 Score = 56.2 bits (134), Expect = 9e-06 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -2 Query: 212 ADWQKGEANHTGGRTKPLVATCSFYDKLVRVWRPENDIIL 93 ADWQ+G+ + G + P++ATCSFYD+L+ VW PE D+ + Sbjct: 322 ADWQRGDVSVVGRKKSPVIATCSFYDRLLHVWTPEGDVFV 361