BLASTX nr result
ID: Wisteria21_contig00038434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038434 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN42062.1| hypothetical protein glysoja_003802 [Glycine soja... 98 2e-18 gb|KHN36208.1| hypothetical protein glysoja_003331 [Glycine soja... 89 2e-15 ref|XP_007156826.1| hypothetical protein PHAVU_002G021000g [Phas... 86 1e-14 ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobrom... 85 2e-14 gb|KJB40248.1| hypothetical protein B456_007G053400 [Gossypium r... 79 2e-12 emb|CBI18827.3| unnamed protein product [Vitis vinifera] 76 1e-11 gb|KNA21010.1| hypothetical protein SOVF_047180 [Spinacia oleracea] 63 1e-07 gb|ACG28136.1| hypothetical protein [Zea mays] gi|195617542|gb|A... 61 3e-07 gb|KQL30617.1| hypothetical protein SETIT_020568mg [Setaria ital... 60 5e-07 >gb|KHN42062.1| hypothetical protein glysoja_003802 [Glycine soja] gi|947079716|gb|KRH28505.1| hypothetical protein GLYMA_11G058200 [Glycine max] Length = 50 Score = 98.2 bits (243), Expect = 2e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCNFC 100 M+PP +QSIEIS YQAGDD QDKVI+ECCSCCYDCTQG FD+LCCNFC Sbjct: 1 MEPPPSQSIEISGHGYQAGDDTQDKVINECCSCCYDCTQGLFDFLCCNFC 50 >gb|KHN36208.1| hypothetical protein glysoja_003331 [Glycine soja] gi|947129101|gb|KRH76955.1| hypothetical protein GLYMA_01G184100 [Glycine max] Length = 50 Score = 88.6 bits (218), Expect = 2e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCNFC 100 M+PP +QSIE+S T QAGDD QDK+I+E SCCYDCTQG FD+LCCNFC Sbjct: 1 MEPPPSQSIEVSGTGCQAGDDTQDKIINEWLSCCYDCTQGIFDFLCCNFC 50 >ref|XP_007156826.1| hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] gi|561030241|gb|ESW28820.1| hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] Length = 44 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCNFC 100 M+PP +QSI+I AGDD QDKVI+ECCSCCYDCTQG FD+LCCNFC Sbjct: 1 MEPPPSQSIQI------AGDDSQDKVINECCSCCYDCTQGLFDFLCCNFC 44 >ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobroma cacao] gi|508699438|gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 85.1 bits (209), Expect = 2e-14 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCC-NFC 100 M+ P QSIE S+ N+Q +DEQDK +DECCSCCYDCT+ CFDYLCC N C Sbjct: 1 MEAPATQSIETSTNNFQVEEDEQDKAVDECCSCCYDCTETCFDYLCCFNLC 51 >gb|KJB40248.1| hypothetical protein B456_007G053400 [Gossypium raimondii] Length = 51 Score = 78.6 bits (192), Expect = 2e-12 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCC 109 M+PP QSIE S+ ++Q +DEQDK +DECCSCCY+CT FDYLCC Sbjct: 1 MEPPATQSIETSTKSFQVEEDEQDKAVDECCSCCYECTGSIFDYLCC 47 >emb|CBI18827.3| unnamed protein product [Vitis vinifera] Length = 52 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/48 (66%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQA-GDDEQDKVIDECCSCCYDCTQGCFDYLCC 109 MDPP QSIEISS Y G DEQ+KV DECCSCCY CT C D+ CC Sbjct: 1 MDPPPTQSIEISSKTYDIQGQDEQEKVADECCSCCYACTDNCIDFFCC 48 >gb|KNA21010.1| hypothetical protein SOVF_047180 [Spinacia oleracea] Length = 53 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCN--FC 100 M+ P Q++E S Y DD ++K++D+ CSC +DC QG FD+LCCN FC Sbjct: 1 MEAPTTQAVEQPSRGYLGTDDPEEKLLDQSCSCLFDCIQGLFDFLCCNSDFC 52 >gb|ACG28136.1| hypothetical protein [Zea mays] gi|195617542|gb|ACG30601.1| hypothetical protein [Zea mays] Length = 42 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCN 106 M+PP AQ++ A DD QDK +DECCSCCYDC D+LCC+ Sbjct: 1 MEPPSAQAMS-------ATDDFQDKAVDECCSCCYDCCSSILDFLCCS 41 >gb|KQL30617.1| hypothetical protein SETIT_020568mg [Setaria italica] Length = 42 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/48 (56%), Positives = 32/48 (66%) Frame = -3 Query: 249 MDPPQAQSIEISSTNYQAGDDEQDKVIDECCSCCYDCTQGCFDYLCCN 106 MDPP AQ + S+TN D QDK +DECCSCCYDC D+LCC+ Sbjct: 1 MDPPSAQVM--SATN-----DFQDKTVDECCSCCYDCCSSILDFLCCS 41