BLASTX nr result
ID: Wisteria21_contig00038209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038209 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619639.2| pentatricopeptide (PPR) repeat protein [Medi... 61 4e-07 gb|KHN16823.1| hypothetical protein glysoja_002920, partial [Gly... 59 2e-06 >ref|XP_003619639.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382568|gb|AES75857.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 1056 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -1 Query: 174 VWFSIIWKVRNSQVFEAKKVEVEQIVESCKVSSWNWVLTRSIGFPYPMSCWFSN 13 +WF+ IWK RN ++F+ K+V +E IVES K S WNW+ ++ Y +S WF N Sbjct: 670 IWFACIWKARNDKLFKTKEVCLENIVESVKRSCWNWLRFKTNSMEYNLSQWFVN 723 >gb|KHN16823.1| hypothetical protein glysoja_002920, partial [Glycine soja] Length = 72 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -1 Query: 174 VWFSI---IWKVRNSQVFEAKKVEVEQIVESCKVSSWNWVLTRSIGFPYPMSCWFSNPGA 4 +WF+ +W RN +FEA +E E+IVES K+ SW W+ R F Y W SNP Sbjct: 11 IWFATQWAVWNARNQNIFEATVLEKERIVESAKLQSWKWLKVRRKSFVYSFINWCSNPLE 70 Query: 3 C 1 C Sbjct: 71 C 71