BLASTX nr result
ID: Wisteria21_contig00038169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038169 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132049.1| hypothetical protein PHAVU_011G062600g [Phas... 126 5e-27 ref|XP_008349706.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-l... 125 2e-26 ref|XP_008384938.1| PREDICTED: laccase-2-like [Malus domestica] 125 2e-26 ref|XP_006592190.1| PREDICTED: laccase-2-like isoform X2 [Glycin... 124 3e-26 ref|XP_006592189.1| PREDICTED: laccase-2-like isoform X1 [Glycin... 124 3e-26 ref|XP_009375916.1| PREDICTED: laccase-2-like [Pyrus x bretschne... 123 5e-26 ref|XP_004507172.1| PREDICTED: laccase-2-like [Cicer arietinum] 123 6e-26 ref|XP_014519508.1| PREDICTED: laccase-2-like [Vigna radiata var... 122 8e-26 gb|KOM26210.1| hypothetical protein LR48_Vigan238s004300 [Vigna ... 122 8e-26 ref|XP_006590981.1| PREDICTED: laccase-2-like isoform X2 [Glycin... 122 1e-25 ref|XP_006350913.1| PREDICTED: laccase-2-like [Solanum tuberosum] 122 1e-25 ref|XP_003539077.1| PREDICTED: laccase-2-like isoform X1 [Glycin... 122 1e-25 ref|XP_003606701.1| laccase/diphenol oxidase family protein [Med... 122 1e-25 ref|XP_007208016.1| hypothetical protein PRUPE_ppa003296mg [Prun... 121 2e-25 ref|XP_010106521.1| hypothetical protein L484_025281 [Morus nota... 120 4e-25 ref|XP_011095204.1| PREDICTED: laccase-17-like [Sesamum indicum] 120 4e-25 ref|XP_011032272.1| PREDICTED: laccase-2-like [Populus euphratica] 120 5e-25 ref|XP_008222248.1| PREDICTED: laccase-2 [Prunus mume] 120 5e-25 gb|KDO72817.1| hypothetical protein CISIN_1g038598mg, partial [C... 120 5e-25 ref|XP_002313424.1| hypothetical protein POPTR_0009s03940g [Popu... 120 5e-25 >ref|XP_007132049.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris] gi|561005049|gb|ESW04043.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris] Length = 607 Score = 126 bits (317), Expect = 5e-27 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 535 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 590 >ref|XP_008349706.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Malus domestica] Length = 376 Score = 125 bits (313), Expect = 2e-26 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAW+V+DG Sbjct: 304 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDG 359 >ref|XP_008384938.1| PREDICTED: laccase-2-like [Malus domestica] Length = 585 Score = 125 bits (313), Expect = 2e-26 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAW+V+DG Sbjct: 513 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDG 568 >ref|XP_006592190.1| PREDICTED: laccase-2-like isoform X2 [Glycine max] Length = 588 Score = 124 bits (311), Expect = 3e-26 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 517 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 571 >ref|XP_006592189.1| PREDICTED: laccase-2-like isoform X1 [Glycine max] gi|734402659|gb|KHN32142.1| Laccase-2 [Glycine soja] gi|947075921|gb|KRH24761.1| hypothetical protein GLYMA_12G060900 [Glycine max] gi|947075922|gb|KRH24762.1| hypothetical protein GLYMA_12G060900 [Glycine max] Length = 590 Score = 124 bits (311), Expect = 3e-26 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 519 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 573 >ref|XP_009375916.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri] Length = 585 Score = 123 bits (309), Expect = 5e-26 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERN+VGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAW+V+DG Sbjct: 513 NFNLVDPVERNSVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQDG 568 >ref|XP_004507172.1| PREDICTED: laccase-2-like [Cicer arietinum] Length = 594 Score = 123 bits (308), Expect = 6e-26 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTVGVP+GGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 523 FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 577 >ref|XP_014519508.1| PREDICTED: laccase-2-like [Vigna radiata var. radiata] Length = 587 Score = 122 bits (307), Expect = 8e-26 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVH SWGLRMAWIVEDG Sbjct: 516 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHFSWGLRMAWIVEDG 570 >gb|KOM26210.1| hypothetical protein LR48_Vigan238s004300 [Vigna angularis] Length = 586 Score = 122 bits (307), Expect = 8e-26 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVH SWGLRMAWIVEDG Sbjct: 515 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHFSWGLRMAWIVEDG 569 >ref|XP_006590981.1| PREDICTED: laccase-2-like isoform X2 [Glycine max] gi|734378249|gb|KHN21934.1| Laccase-2 [Glycine soja] gi|947080976|gb|KRH29765.1| hypothetical protein GLYMA_11G137500 [Glycine max] Length = 586 Score = 122 bits (306), Expect = 1e-25 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNL DPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 515 FNLFDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 569 >ref|XP_006350913.1| PREDICTED: laccase-2-like [Solanum tuberosum] Length = 584 Score = 122 bits (306), Expect = 1e-25 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 N+NLVDPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIV DG Sbjct: 512 NYNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDG 567 >ref|XP_003539077.1| PREDICTED: laccase-2-like isoform X1 [Glycine max] Length = 584 Score = 122 bits (306), Expect = 1e-25 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNL DPVERNTVGVPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 513 FNLFDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 567 >ref|XP_003606701.1| laccase/diphenol oxidase family protein [Medicago truncatula] gi|355507756|gb|AES88898.1| laccase/diphenol oxidase family protein [Medicago truncatula] Length = 585 Score = 122 bits (305), Expect = 1e-25 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNTV VPSGGWVAIRFLADNPGVW+MHCHFDVHLSWGLRMAWIVEDG Sbjct: 514 FNLVDPVERNTVAVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVEDG 568 >ref|XP_007208016.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica] gi|462403658|gb|EMJ09215.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica] Length = 587 Score = 121 bits (304), Expect = 2e-25 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 +FNLVDPVERNT+GVPSGGWVAIRFLADNPGVW++HCHFDVHLSWGLRMAW+V+DG Sbjct: 515 SFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWLLHCHFDVHLSWGLRMAWVVQDG 570 >ref|XP_010106521.1| hypothetical protein L484_025281 [Morus notabilis] gi|587923347|gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis] Length = 577 Score = 120 bits (301), Expect = 4e-25 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNLVDPVERNT+GVPSGGW AIRFLADNPGVW MHCHFDVHLSWGLRMAWIV+DG Sbjct: 506 FNLVDPVERNTIGVPSGGWAAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVQDG 560 >ref|XP_011095204.1| PREDICTED: laccase-17-like [Sesamum indicum] Length = 579 Score = 120 bits (301), Expect = 4e-25 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNT+GVPSGGWVAIRFLADNPGVW MHCHFDVH SWGLRMAWIV DG Sbjct: 507 NFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHFDVHTSWGLRMAWIVLDG 562 >ref|XP_011032272.1| PREDICTED: laccase-2-like [Populus euphratica] Length = 576 Score = 120 bits (300), Expect = 5e-25 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNTVGVPSGGWVAIRF ADNPGVW MHCHFDVHLSWGLRMAWIV DG Sbjct: 504 NFNLVDPVERNTVGVPSGGWVAIRFHADNPGVWFMHCHFDVHLSWGLRMAWIVLDG 559 >ref|XP_008222248.1| PREDICTED: laccase-2 [Prunus mume] Length = 587 Score = 120 bits (300), Expect = 5e-25 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 +FNLVDPVERNT+GVPSGGW AIRFLADNPGVW++HCHFDVHLSWGLRMAW+V+DG Sbjct: 515 SFNLVDPVERNTIGVPSGGWAAIRFLADNPGVWLLHCHFDVHLSWGLRMAWVVQDG 570 >gb|KDO72817.1| hypothetical protein CISIN_1g038598mg, partial [Citrus sinensis] Length = 392 Score = 120 bits (300), Expect = 5e-25 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -3 Query: 428 FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 FNL+DPVERNTVGVPSGGWVAIRFLADNPGVW MHCHFDVHLSWGLRMAWIV DG Sbjct: 321 FNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVLDG 375 >ref|XP_002313424.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa] gi|222849832|gb|EEE87379.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa] Length = 576 Score = 120 bits (300), Expect = 5e-25 Identities = 53/56 (94%), Positives = 53/56 (94%) Frame = -3 Query: 431 NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWVMHCHFDVHLSWGLRMAWIVEDG 264 NFNLVDPVERNTVGVPSGGWVAIRF ADNPGVW MHCHFDVHLSWGLRMAWIV DG Sbjct: 504 NFNLVDPVERNTVGVPSGGWVAIRFHADNPGVWFMHCHFDVHLSWGLRMAWIVLDG 559