BLASTX nr result
ID: Wisteria21_contig00038095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00038095 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548424.2| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_003529895.2| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_004516409.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_014516302.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_013444656.1| pentatricopeptide (PPR) repeat protein [Medi... 67 7e-09 ref|XP_007135239.1| hypothetical protein PHAVU_010G112400g [Phas... 61 3e-07 gb|KHN06297.1| Pentatricopeptide repeat-containing protein, mito... 60 6e-07 gb|KRH47930.1| hypothetical protein GLYMA_07G057000 [Glycine max] 59 1e-06 >ref|XP_003548424.2| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Glycine max] Length = 945 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 M F Q+ SFMD LA PFHHLNPY VHNPQTHMPPRSHS P+SISL +S+ L Sbjct: 1 MTFSFSFQYHSFMDNLAAPFHHLNPYFVHNPQTHMPPRSHS-PSSISLGMSEAQL 54 >ref|XP_003529895.2| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Glycine max] Length = 945 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/55 (65%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 M FCI Q+ SFMD LA PFHHLN Y VHNPQ HMPPR HS P+S+SL S+T + Sbjct: 1 MTFCISFQYHSFMDNLAAPFHHLNSYFVHNPQGHMPPRRHS-PSSVSLGTSETQI 54 >ref|XP_004516409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial isoform X1 [Cicer arietinum] gi|502179330|ref|XP_004516410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial isoform X2 [Cicer arietinum] Length = 950 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLAPFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTH 343 M FCI S HQ FM+ L+PFHH NP+S+HNP+T M P+S S P SISL I DTH Sbjct: 1 MTFCIISNHQIFMNNLSPFHHHNPFSLHNPKTQMLPKSLS-PISISLPIQDTH 52 >ref|XP_014516302.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial [Vigna radiata var. radiata] Length = 948 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 M CI SFMD L PFHHLNPY V NPQTHM PRSHS PTS+S+ IS+ L Sbjct: 1 MTLCIAIHRHSFMDNLVQPFHHLNPYFVQNPQTHMQPRSHS-PTSVSVGISEPQL 54 >ref|XP_013444656.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657372911|gb|KEH18681.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 967 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLAPFHHLNPYSVHNPQTHMPPRSHSQPTSIS 322 M C+FS+HQ FM+ L+PFHHLNP+S+HNP+T M PRS S P SIS Sbjct: 1 MTLCVFSKHQIFMNNLSPFHHLNPHSLHNPKTQMLPRSLS-PISIS 45 >ref|XP_007135239.1| hypothetical protein PHAVU_010G112400g [Phaseolus vulgaris] gi|561008284|gb|ESW07233.1| hypothetical protein PHAVU_010G112400g [Phaseolus vulgaris] Length = 946 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +2 Query: 185 MAFCIFSQHQSFMDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 M CI SFMD L PFH LNPY V NPQTHM PRS S PTS+SL +S++ L Sbjct: 1 MTLCIAFHSHSFMDNLVQPFHLLNPYVVQNPQTHMQPRSLS-PTSVSLGMSESQL 54 >gb|KHN06297.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 933 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/43 (69%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 221 MDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 MD LA PFHHLN Y VHNPQ HMPPR HS P+S+SL S+T L Sbjct: 1 MDNLAAPFHHLNSYFVHNPQGHMPPRRHS-PSSVSLGTSETQL 42 >gb|KRH47930.1| hypothetical protein GLYMA_07G057000 [Glycine max] Length = 933 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 221 MDKLA-PFHHLNPYSVHNPQTHMPPRSHSQPTSISLEISDTHL 346 MD LA PFHHLN Y VHNPQ HMPPR HS P+S+SL S+T + Sbjct: 1 MDNLAAPFHHLNSYFVHNPQGHMPPRRHS-PSSVSLGTSETQI 42