BLASTX nr result
ID: Wisteria21_contig00037459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00037459 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH31673.1| hypothetical protein GLYMA_10G004100 [Glycine max] 60 5e-07 gb|KHN10069.1| hypothetical protein glysoja_034311 [Glycine soja] 60 5e-07 gb|KRH69105.1| hypothetical protein GLYMA_02G004200 [Glycine max] 58 3e-06 gb|KHN00274.1| hypothetical protein glysoja_022878 [Glycine soja] 58 3e-06 ref|XP_003519712.1| PREDICTED: uncharacterized protein LOC100776... 58 3e-06 gb|KRH34414.1| hypothetical protein GLYMA_10G182300 [Glycine max] 57 5e-06 gb|KHN30584.1| hypothetical protein glysoja_030021 [Glycine soja] 57 5e-06 ref|XP_013467040.1| COP1-interacting-like protein [Medicago trun... 57 5e-06 ref|XP_003590837.2| COP1-interacting-like protein [Medicago trun... 57 7e-06 >gb|KRH31673.1| hypothetical protein GLYMA_10G004100 [Glycine max] Length = 1239 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDLFITVNGK Sbjct: 1 MNSSTRLDSAVFQLTPTRTRFDLFITVNGK 30 >gb|KHN10069.1| hypothetical protein glysoja_034311 [Glycine soja] Length = 1239 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDLFITVNGK Sbjct: 1 MNSSTRLDSAVFQLTPTRTRFDLFITVNGK 30 >gb|KRH69105.1| hypothetical protein GLYMA_02G004200 [Glycine max] Length = 1249 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNSSTRLDSAVFQLTPTRTRFDLVITVNGK 30 >gb|KHN00274.1| hypothetical protein glysoja_022878 [Glycine soja] Length = 1243 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNSSTRLDSAVFQLTPTRTRFDLVITVNGK 30 >ref|XP_003519712.1| PREDICTED: uncharacterized protein LOC100776852 isoform X1 [Glycine max] gi|947120898|gb|KRH69104.1| hypothetical protein GLYMA_02G004200 [Glycine max] Length = 1243 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNSSTRLDSAVFQLTPTRTRFDLVITVNGK 30 >gb|KRH34414.1| hypothetical protein GLYMA_10G182300 [Glycine max] Length = 1293 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MN+S RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNTSTRLDSAVFQLTPTRTRFDLIITVNGK 30 >gb|KHN30584.1| hypothetical protein glysoja_030021 [Glycine soja] Length = 1293 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MN+S RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNTSTRLDSAVFQLTPTRTRFDLIITVNGK 30 >ref|XP_013467040.1| COP1-interacting-like protein [Medicago truncatula] gi|657402148|gb|KEH41075.1| COP1-interacting-like protein [Medicago truncatula] Length = 1197 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS RLDSAVFQLTPTRTRFDL ITVNGK Sbjct: 1 MNSSPRLDSAVFQLTPTRTRFDLVITVNGK 30 >ref|XP_003590837.2| COP1-interacting-like protein [Medicago truncatula] gi|657403969|gb|AES61088.2| COP1-interacting-like protein [Medicago truncatula] Length = 1267 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 92 MNSSVRLDSAVFQLTPTRTRFDLFITVNGK 3 MNSS+RLDSAVFQLTPTRTRFDL ITV+GK Sbjct: 1 MNSSMRLDSAVFQLTPTRTRFDLIITVHGK 30