BLASTX nr result
ID: Wisteria21_contig00036126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036126 (284 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAV88069.1| hypothetical retrotransposon [Ipomoea batatas] 59 1e-06 dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] 49 9e-06 >gb|AAV88069.1| hypothetical retrotransposon [Ipomoea batatas] Length = 1415 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +2 Query: 104 DIFLVGEDNYLNVASDECIWIIDSGASFHVTPHEEFFSSYQKGRFW---YGEDG 256 D+ + +DN +NVA E WI+DSGA++HVTP +EFF+SY G F G DG Sbjct: 270 DLLVACDDNVINVACHETTWIVDSGAAYHVTPRKEFFTSYTPGDFGELRMGNDG 323 >dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] Length = 1338 Score = 48.9 bits (115), Expect(2) = 9e-06 Identities = 20/42 (47%), Positives = 28/42 (66%) Frame = +2 Query: 113 LVGEDNYLNVASDECIWIIDSGASFHVTPHEEFFSSYQKGRF 238 +V +D+ +N+ + E W+IDSGA+ H TP E FSSY G F Sbjct: 276 VVYDDDIINLTTQEMTWVIDSGATIHATPRRELFSSYTLGDF 317 Score = 26.9 bits (58), Expect(2) = 9e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 231 GDFGTVKMGNHVTSKIVG 284 GDFG VKMGN S +VG Sbjct: 315 GDFGRVKMGNANFSTVVG 332