BLASTX nr result
ID: Wisteria21_contig00036099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036099 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH68107.1| hypothetical protein GLYMA_03G209300 [Glycine max] 65 2e-08 >gb|KRH68107.1| hypothetical protein GLYMA_03G209300 [Glycine max] Length = 61 Score = 65.5 bits (158), Expect = 2e-08 Identities = 36/47 (76%), Positives = 37/47 (78%) Frame = +2 Query: 161 MKIESLRLAF*HILHRCNNPCRKTTRCAEMLSQLMPIILSSSATLQH 301 MK ESLRLAF HILHR NNPC K TRCA+ LS LMPIILSS AT H Sbjct: 1 MKGESLRLAFWHILHRNNNPC-KNTRCAQTLSLLMPIILSSPATPLH 46