BLASTX nr result
ID: Wisteria21_contig00036070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036070 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004502055.1| PREDICTED: HEAT repeat-containing protein 6 ... 115 1e-23 ref|XP_003601433.2| armadillo/beta-catenin-like repeat protein [... 114 2e-23 gb|KRH54374.1| hypothetical protein GLYMA_06G181000 [Glycine max] 105 1e-20 gb|KRH54373.1| hypothetical protein GLYMA_06G181000 [Glycine max] 105 1e-20 gb|KHN19291.1| hypothetical protein glysoja_012211 [Glycine soja] 105 1e-20 ref|XP_006581921.1| PREDICTED: HEAT repeat-containing protein 6-... 105 1e-20 ref|XP_006581920.1| PREDICTED: HEAT repeat-containing protein 6-... 105 1e-20 gb|KOM49432.1| hypothetical protein LR48_Vigan08g025900 [Vigna a... 103 5e-20 ref|XP_014493909.1| PREDICTED: HEAT repeat-containing protein 6 ... 102 1e-19 ref|XP_014493908.1| PREDICTED: HEAT repeat-containing protein 6 ... 102 1e-19 ref|XP_014493906.1| PREDICTED: HEAT repeat-containing protein 6 ... 102 1e-19 ref|XP_014493904.1| PREDICTED: HEAT repeat-containing protein 6 ... 102 1e-19 ref|XP_014493903.1| PREDICTED: HEAT repeat-containing protein 6 ... 102 1e-19 ref|XP_010251003.1| PREDICTED: HEAT repeat-containing protein 6 ... 98 3e-18 ref|XP_010250994.1| PREDICTED: HEAT repeat-containing protein 6 ... 98 3e-18 ref|XP_007133296.1| hypothetical protein PHAVU_011G167600g [Phas... 98 3e-18 ref|XP_007133295.1| hypothetical protein PHAVU_011G167600g [Phas... 98 3e-18 ref|XP_010053993.1| PREDICTED: HEAT repeat-containing protein 6 ... 97 6e-18 ref|XP_010053992.1| PREDICTED: HEAT repeat-containing protein 6 ... 97 6e-18 ref|XP_011470853.1| PREDICTED: HEAT repeat-containing protein 6 ... 94 4e-17 >ref|XP_004502055.1| PREDICTED: HEAT repeat-containing protein 6 [Cicer arietinum] Length = 1182 Score = 115 bits (288), Expect = 1e-23 Identities = 55/63 (87%), Positives = 60/63 (95%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVRSWRTAFLTLRDETLT PPRTST+QMLHNLIFSHSH L+ AAPELPSHEVLSDI+F++ Sbjct: 15 LVRSWRTAFLTLRDETLTNPPRTSTSQMLHNLIFSHSHTLLCAAPELPSHEVLSDIVFMM 74 Query: 11 ELV 3 ELV Sbjct: 75 ELV 77 >ref|XP_003601433.2| armadillo/beta-catenin-like repeat protein [Medicago truncatula] gi|657394541|gb|AES71684.2| armadillo/beta-catenin-like repeat protein [Medicago truncatula] Length = 1088 Score = 114 bits (286), Expect = 2e-23 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L+RSWRTAFLTLRDE+LT PPR ST+QMLHNLIFSHSH L+SAAPELPSHEVLSDILF++ Sbjct: 15 LIRSWRTAFLTLRDESLTNPPRNSTSQMLHNLIFSHSHTLLSAAPELPSHEVLSDILFMM 74 Query: 11 ELV 3 ELV Sbjct: 75 ELV 77 >gb|KRH54374.1| hypothetical protein GLYMA_06G181000 [Glycine max] Length = 420 Score = 105 bits (263), Expect = 1e-20 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVR WRTAFLTLRDETLT PPR STAQ+L NLIFSHS AL+SAA ELPSHEVLSDILF++ Sbjct: 14 LVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELPSHEVLSDILFIM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >gb|KRH54373.1| hypothetical protein GLYMA_06G181000 [Glycine max] Length = 567 Score = 105 bits (263), Expect = 1e-20 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVR WRTAFLTLRDETLT PPR STAQ+L NLIFSHS AL+SAA ELPSHEVLSDILF++ Sbjct: 14 LVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELPSHEVLSDILFIM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >gb|KHN19291.1| hypothetical protein glysoja_012211 [Glycine soja] Length = 327 Score = 105 bits (263), Expect = 1e-20 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVR WRTAFLTLRDETLT PPR STAQ+L NLIFSHS AL+SAA ELPSHEVLSDILF++ Sbjct: 14 LVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELPSHEVLSDILFIM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_006581921.1| PREDICTED: HEAT repeat-containing protein 6-like isoform X2 [Glycine max] Length = 1188 Score = 105 bits (263), Expect = 1e-20 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVR WRTAFLTLRDETLT PPR STAQ+L NLIFSHS AL+SAA ELPSHEVLSDILF++ Sbjct: 14 LVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELPSHEVLSDILFIM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_006581920.1| PREDICTED: HEAT repeat-containing protein 6-like isoform X1 [Glycine max] Length = 1256 Score = 105 bits (263), Expect = 1e-20 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVR WRTAFLTLRDETLT PPR STAQ+L NLIFSHS AL+SAA ELPSHEVLSDILF++ Sbjct: 14 LVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELPSHEVLSDILFIM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >gb|KOM49432.1| hypothetical protein LR48_Vigan08g025900 [Vigna angularis] Length = 420 Score = 103 bits (257), Expect = 5e-20 Identities = 52/63 (82%), Positives = 56/63 (88%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVRSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LVRSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_014493909.1| PREDICTED: HEAT repeat-containing protein 6 isoform X7 [Vigna radiata var. radiata] Length = 930 Score = 102 bits (253), Expect = 1e-19 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L RSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LARSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_014493908.1| PREDICTED: HEAT repeat-containing protein 6 isoform X6 [Vigna radiata var. radiata] Length = 936 Score = 102 bits (253), Expect = 1e-19 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L RSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LARSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_014493906.1| PREDICTED: HEAT repeat-containing protein 6 isoform X4 [Vigna radiata var. radiata] Length = 1043 Score = 102 bits (253), Expect = 1e-19 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L RSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LARSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_014493904.1| PREDICTED: HEAT repeat-containing protein 6 isoform X2 [Vigna radiata var. radiata] Length = 1129 Score = 102 bits (253), Expect = 1e-19 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L RSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LARSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_014493903.1| PREDICTED: HEAT repeat-containing protein 6 isoform X1 [Vigna radiata var. radiata] Length = 1190 Score = 102 bits (253), Expect = 1e-19 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 L RSWRTAFLTLRDETLT PPR S Q+L NLI SHS+ALVSAA ELPSHEVLSDILF++ Sbjct: 14 LARSWRTAFLTLRDETLTIPPRNSNVQLLDNLILSHSNALVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_010251003.1| PREDICTED: HEAT repeat-containing protein 6 isoform X2 [Nelumbo nucifera] Length = 1201 Score = 97.8 bits (242), Expect = 3e-18 Identities = 47/62 (75%), Positives = 53/62 (85%) Frame = -3 Query: 188 VRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLVE 9 +RSWRTAFLTLRDETLT PPRTS +LH+ IFSHS +LV AAPELP HEV SD++FLVE Sbjct: 7 LRSWRTAFLTLRDETLTFPPRTSLLSLLHHFIFSHSDSLVVAAPELPLHEVTSDVMFLVE 66 Query: 8 LV 3 LV Sbjct: 67 LV 68 >ref|XP_010250994.1| PREDICTED: HEAT repeat-containing protein 6 isoform X1 [Nelumbo nucifera] Length = 1207 Score = 97.8 bits (242), Expect = 3e-18 Identities = 47/62 (75%), Positives = 53/62 (85%) Frame = -3 Query: 188 VRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLVE 9 +RSWRTAFLTLRDETLT PPRTS +LH+ IFSHS +LV AAPELP HEV SD++FLVE Sbjct: 7 LRSWRTAFLTLRDETLTFPPRTSLLSLLHHFIFSHSDSLVVAAPELPLHEVTSDVMFLVE 66 Query: 8 LV 3 LV Sbjct: 67 LV 68 >ref|XP_007133296.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] gi|561006296|gb|ESW05290.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] Length = 590 Score = 97.8 bits (242), Expect = 3e-18 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVRSWRTAFLTLRDETLT P R S Q+L NLI SHS LVSAA ELPSHEVLSDILF++ Sbjct: 14 LVRSWRTAFLTLRDETLTIPSRNSNVQLLDNLILSHSKPLVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_007133295.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] gi|561006295|gb|ESW05289.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] Length = 609 Score = 97.8 bits (242), Expect = 3e-18 Identities = 50/63 (79%), Positives = 53/63 (84%) Frame = -3 Query: 191 LVRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLV 12 LVRSWRTAFLTLRDETLT P R S Q+L NLI SHS LVSAA ELPSHEVLSDILF++ Sbjct: 14 LVRSWRTAFLTLRDETLTIPSRNSNVQLLDNLILSHSKPLVSAAVELPSHEVLSDILFMM 73 Query: 11 ELV 3 ELV Sbjct: 74 ELV 76 >ref|XP_010053993.1| PREDICTED: HEAT repeat-containing protein 6 isoform X2 [Eucalyptus grandis] Length = 1182 Score = 96.7 bits (239), Expect = 6e-18 Identities = 45/62 (72%), Positives = 53/62 (85%) Frame = -3 Query: 188 VRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLVE 9 +RSWRT FLTLRDETLT+PPRTS A +LH LIFS+ ALV+A+P LP HEV SD+LFL+E Sbjct: 21 IRSWRTGFLTLRDETLTSPPRTSLADLLHGLIFSNPSALVAASPNLPPHEVTSDVLFLIE 80 Query: 8 LV 3 LV Sbjct: 81 LV 82 >ref|XP_010053992.1| PREDICTED: HEAT repeat-containing protein 6 isoform X1 [Eucalyptus grandis] gi|629113405|gb|KCW78365.1| hypothetical protein EUGRSUZ_D02539 [Eucalyptus grandis] Length = 1204 Score = 96.7 bits (239), Expect = 6e-18 Identities = 45/62 (72%), Positives = 53/62 (85%) Frame = -3 Query: 188 VRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLVE 9 +RSWRT FLTLRDETLT+PPRTS A +LH LIFS+ ALV+A+P LP HEV SD+LFL+E Sbjct: 21 IRSWRTGFLTLRDETLTSPPRTSLADLLHGLIFSNPSALVAASPNLPPHEVTSDVLFLIE 80 Query: 8 LV 3 LV Sbjct: 81 LV 82 >ref|XP_011470853.1| PREDICTED: HEAT repeat-containing protein 6 isoform X1 [Fragaria vesca subsp. vesca] gi|764641377|ref|XP_011470854.1| PREDICTED: HEAT repeat-containing protein 6 isoform X2 [Fragaria vesca subsp. vesca] Length = 1207 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = -3 Query: 188 VRSWRTAFLTLRDETLTTPPRTSTAQMLHNLIFSHSHALVSAAPELPSHEVLSDILFLVE 9 VR WRTAFLT+RDE+LTTPPRT +LHN IFSHSH L+SAAP+LP EV SD+LF++E Sbjct: 49 VRWWRTAFLTVRDESLTTPPRTPIPDLLHNFIFSHSHTLLSAAPDLPPPEVTSDLLFVME 108 Query: 8 LV 3 LV Sbjct: 109 LV 110