BLASTX nr result
ID: Wisteria21_contig00036064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036064 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN19745.1| TPR repeat-containing thioredoxin TTL1 [Glycine s... 77 5e-12 ref|XP_003523822.1| PREDICTED: TPR repeat-containing thioredoxin... 77 5e-12 gb|KOM41694.1| hypothetical protein LR48_Vigan04g189200 [Vigna a... 69 2e-09 ref|XP_004500618.1| PREDICTED: inactive TPR repeat-containing th... 68 3e-09 gb|KHN09126.1| TPR repeat-containing thioredoxin TTL1-like prote... 67 7e-09 ref|XP_003527909.1| PREDICTED: TPR repeat-containing thioredoxin... 67 7e-09 ref|XP_014502104.1| PREDICTED: TPR repeat-containing thioredoxin... 66 1e-08 ref|XP_007136238.1| hypothetical protein PHAVU_009G030000g [Phas... 65 2e-08 ref|XP_013460873.1| TPR repeat thioredoxin TTL1-like protein [Me... 58 3e-06 ref|XP_013460872.1| TPR repeat thioredoxin TTL1-like protein [Me... 58 3e-06 ref|XP_007141164.1| hypothetical protein PHAVU_008G172500g [Phas... 56 9e-06 ref|XP_003615062.1| inactive TPR repeat thioredoxin TTL3-like pr... 56 9e-06 >gb|KHN19745.1| TPR repeat-containing thioredoxin TTL1 [Glycine soja] Length = 625 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/57 (66%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLKSS-KLRNSSVHSLPMKANNNAQQNDQGKNETK 6 MAGK +NK+EV+LGC VGRIF LK++ + R SSVHSLP+K N AQQ DQGKNE+K Sbjct: 1 MAGKTKNKVEVQLGCGLVGRIFHLKTNNRPRKSSVHSLPLKPCNTAQQRDQGKNESK 57 >ref|XP_003523822.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] gi|947114066|gb|KRH62368.1| hypothetical protein GLYMA_04G103400 [Glycine max] Length = 654 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/57 (66%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLKSS-KLRNSSVHSLPMKANNNAQQNDQGKNETK 6 MAGK +NK+EV+LGC VGRIF LK++ + R SSVHSLP+K N AQQ DQGKNE+K Sbjct: 1 MAGKTKNKVEVQLGCGLVGRIFHLKTNNRPRKSSVHSLPLKPCNTAQQRDQGKNESK 57 >gb|KOM41694.1| hypothetical protein LR48_Vigan04g189200 [Vigna angularis] Length = 688 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/57 (59%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLKSS-KLRNSSVHSLPMKANNNAQQNDQGKNETK 6 M GKA++K++ + GC VGRIF LK++ + R SSVHSLPMK N AQQ DQ KNE K Sbjct: 1 MEGKAKDKVDFDFGCGLVGRIFHLKTNYRTRKSSVHSLPMKPCNTAQQRDQAKNEFK 57 >ref|XP_004500618.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3 [Cicer arietinum] Length = 650 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/51 (66%), Positives = 43/51 (84%), Gaps = 2/51 (3%) Frame = -3 Query: 173 MAGKA-RNKLE-VELGCSFVGRIFKLKSSKLRNSSVHSLPMKANNNAQQND 27 M GK +NK+E VELGC+F+G+IFKLK++KLRNSSVHSLP+K NN QN+ Sbjct: 1 MEGKTNKNKVEKVELGCNFMGKIFKLKNNKLRNSSVHSLPIKNTNNTHQNE 51 >gb|KHN09126.1| TPR repeat-containing thioredoxin TTL1-like protein [Glycine soja] Length = 698 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLK-SSKLRNSSVHSLPMKANNNA--QQNDQGKNETK 6 MA K +NK+EV+LGC +GRIF LK +++ R SSVHSLP+K NN QQ DQ KNE K Sbjct: 1 MAEKTKNKVEVQLGCGLMGRIFHLKTNNRTRKSSVHSLPVKVCNNTAQQQRDQAKNEAK 59 >ref|XP_003527909.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] gi|947104702|gb|KRH53085.1| hypothetical protein GLYMA_06G104600 [Glycine max] Length = 698 Score = 66.6 bits (161), Expect = 7e-09 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLK-SSKLRNSSVHSLPMKANNNA--QQNDQGKNETK 6 MA K +NK+EV+LGC +GRIF LK +++ R SSVHSLP+K NN QQ DQ KNE K Sbjct: 1 MAEKTKNKVEVQLGCGLMGRIFHLKTNNRTRKSSVHSLPVKVCNNTAQQQRDQAKNEAK 59 >ref|XP_014502104.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Vigna radiata var. radiata] Length = 685 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/57 (57%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLKSS-KLRNSSVHSLPMKANNNAQQNDQGKNETK 6 M GKA++K++ +LGC VGRIF LK++ + R SSVHSLPMK N AQQ DQ N+ K Sbjct: 1 MEGKAKDKVDFDLGCGLVGRIFHLKTNYRTRKSSVHSLPMKPCNTAQQRDQAINDFK 57 >ref|XP_007136238.1| hypothetical protein PHAVU_009G030000g [Phaseolus vulgaris] gi|561009325|gb|ESW08232.1| hypothetical protein PHAVU_009G030000g [Phaseolus vulgaris] Length = 690 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKARNKLEVELGCSFVGRIFKLKSS-KLRNSSVHSLPMKANNNAQQNDQGKNETK 6 M GK +++++ ++GC VG+IF LK++ + R SSVHSLPMKA N AQQ +Q KNE K Sbjct: 1 MEGKTKDRVDFDVGCGLVGKIFHLKTNNRPRKSSVHSLPMKACNTAQQREQAKNELK 57 >ref|XP_013460873.1| TPR repeat thioredoxin TTL1-like protein [Medicago truncatula] gi|657394238|gb|KEH34907.1| TPR repeat thioredoxin TTL1-like protein [Medicago truncatula] Length = 610 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/52 (61%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = -3 Query: 173 MAGKA-RNKLE-VELGCSFVGRIFKLKSSKLRN-SSVHSLPMKANNNAQQND 27 M GK +NK+E V LGC+F+G+IFK K++KLRN SSVHSLP+K NN QQ + Sbjct: 1 MEGKINKNKVEKVVLGCTFMGKIFKFKTNKLRNSSSVHSLPIKTVNNTQQKE 52 >ref|XP_013460872.1| TPR repeat thioredoxin TTL1-like protein [Medicago truncatula] gi|657394237|gb|KEH34906.1| TPR repeat thioredoxin TTL1-like protein [Medicago truncatula] Length = 656 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/52 (61%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = -3 Query: 173 MAGKA-RNKLE-VELGCSFVGRIFKLKSSKLRN-SSVHSLPMKANNNAQQND 27 M GK +NK+E V LGC+F+G+IFK K++KLRN SSVHSLP+K NN QQ + Sbjct: 1 MEGKINKNKVEKVVLGCTFMGKIFKFKTNKLRNSSSVHSLPIKTVNNTQQKE 52 >ref|XP_007141164.1| hypothetical protein PHAVU_008G172500g [Phaseolus vulgaris] gi|561014297|gb|ESW13158.1| hypothetical protein PHAVU_008G172500g [Phaseolus vulgaris] Length = 697 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 173 MAGKAR-NKLEVELGCSFVGRIFKLKSSKLRNSSVHSLPMKANNNAQQNDQGKNE 12 MA KA+ NK+ + GC +GRI LKS KLR SSVHSLP+K N Q +D GK+E Sbjct: 1 MAAKAKKNKVGSQSGCGLMGRILHLKSHKLRKSSVHSLPLK---NPQSDDDGKSE 52 >ref|XP_003615062.1| inactive TPR repeat thioredoxin TTL3-like protein [Medicago truncatula] gi|355516397|gb|AES98020.1| inactive TPR repeat thioredoxin TTL3-like protein [Medicago truncatula] Length = 676 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 173 MAGKAR-NKLEVELGCSFVGRIFKLKSSKLRNSSVHSLPMKANNNAQQNDQGKNETK 6 MA K + NK+ E GC F+ RIF LKS +LRNS VHSLPMK NN D KNE K Sbjct: 1 MAMKTKSNKVGNEFGCGFMERIFNLKSPRLRNSLVHSLPMKGNN----IDHVKNEAK 53