BLASTX nr result
ID: Wisteria21_contig00036036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00036036 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38986.1| RING-H2 finger protein ATL16 [Glycine soja] 63 8e-08 ref|XP_003535440.1| PREDICTED: RING-H2 finger protein ATL16-like... 63 8e-08 ref|XP_003555510.1| PREDICTED: RING-H2 finger protein ATL16-like... 63 1e-07 ref|XP_004495316.1| PREDICTED: RING-H2 finger protein ATL16 [Cic... 60 5e-07 ref|XP_014512737.1| PREDICTED: RING-H2 finger protein ATL16 [Vig... 57 7e-06 gb|KOM52467.1| hypothetical protein LR48_Vigan09g112600 [Vigna a... 57 7e-06 ref|XP_007144094.1| hypothetical protein PHAVU_007G128200g [Phas... 57 7e-06 >gb|KHN38986.1| RING-H2 finger protein ATL16 [Glycine soja] Length = 367 Score = 63.2 bits (152), Expect = 8e-08 Identities = 37/46 (80%), Positives = 37/46 (80%), Gaps = 6/46 (13%) Frame = -3 Query: 120 MDLVSRRYLI----HGSQ--ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDLVSRRYLI HGSQ ALSPITSP GSSIFHPH H SSTSFP Sbjct: 1 MDLVSRRYLIYVSQHGSQPQALSPITSP-GSSIFHPHQHASSTSFP 45 >ref|XP_003535440.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] gi|947085765|gb|KRH34486.1| hypothetical protein GLYMA_10G187100 [Glycine max] Length = 367 Score = 63.2 bits (152), Expect = 8e-08 Identities = 37/46 (80%), Positives = 37/46 (80%), Gaps = 6/46 (13%) Frame = -3 Query: 120 MDLVSRRYLI----HGSQ--ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDLVSRRYLI HGSQ ALSPITSP GSSIFHPH H SSTSFP Sbjct: 1 MDLVSRRYLIYVSQHGSQPQALSPITSP-GSSIFHPHQHASSTSFP 45 >ref|XP_003555510.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] gi|734312881|gb|KHN01059.1| RING-H2 finger protein ATL1 [Glycine soja] gi|947042584|gb|KRG92308.1| hypothetical protein GLYMA_20G203400 [Glycine max] Length = 364 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 6/46 (13%) Frame = -3 Query: 120 MDLVSRRYLIHGSQ------ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDLVSRRYLI+ SQ ALSPITSP GSSIFHPH H SSTSFP Sbjct: 1 MDLVSRRYLIYASQHGPQPQALSPITSP-GSSIFHPHQHSSSTSFP 45 >ref|XP_004495316.1| PREDICTED: RING-H2 finger protein ATL16 [Cicer arietinum] Length = 365 Score = 60.5 bits (145), Expect = 5e-07 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 12/52 (23%) Frame = -3 Query: 120 MDLVSRRYLIHGSQ------------ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDLVSRR+LIH SQ ALSPITS + SSIFHPH+H SSTSFP Sbjct: 1 MDLVSRRHLIHFSQHGSSQISQSNTQALSPITSSSSSSIFHPHMHHSSTSFP 52 >ref|XP_014512737.1| PREDICTED: RING-H2 finger protein ATL16 [Vigna radiata var. radiata] Length = 358 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/46 (67%), Positives = 33/46 (71%), Gaps = 6/46 (13%) Frame = -3 Query: 120 MDLVSRRYLIHGSQ------ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDL SRRYLI+ SQ ALSP+TSP GS FHPH H SSTSFP Sbjct: 1 MDLASRRYLIYVSQHVSQSEALSPVTSPGGS-FFHPHQHSSSTSFP 45 >gb|KOM52467.1| hypothetical protein LR48_Vigan09g112600 [Vigna angularis] Length = 358 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/46 (67%), Positives = 33/46 (71%), Gaps = 6/46 (13%) Frame = -3 Query: 120 MDLVSRRYLIHGSQ------ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDL SRRYLI+ SQ ALSP+TSP GS FHPH H SSTSFP Sbjct: 1 MDLASRRYLIYVSQHVSQSEALSPVTSPGGS-FFHPHQHSSSTSFP 45 >ref|XP_007144094.1| hypothetical protein PHAVU_007G128200g [Phaseolus vulgaris] gi|561017284|gb|ESW16088.1| hypothetical protein PHAVU_007G128200g [Phaseolus vulgaris] Length = 353 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -3 Query: 120 MDLVSRRYLIHGSQ--ALSPITSPAGSSIFHPHLHPSSTSFP 1 MDL SRR+LI+ SQ ALSP+TSP GS FHPH H SSTSFP Sbjct: 1 MDLASRRHLIYESQSQALSPVTSPGGS-FFHPHQHSSSTSFP 41