BLASTX nr result
ID: Wisteria21_contig00035442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035442 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013447244.1| transmembrane protein, putative [Medicago tr... 65 1e-08 >ref|XP_013447244.1| transmembrane protein, putative [Medicago truncatula] gi|657376055|gb|KEH21271.1| transmembrane protein, putative [Medicago truncatula] Length = 76 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 259 MKGRQLMKVDTEDYKEYDSNHRNDQGKGKSHG 164 MKGR LMKVDT+DYKEYDSNH+NDQGKGK HG Sbjct: 45 MKGRLLMKVDTDDYKEYDSNHKNDQGKGKPHG 76