BLASTX nr result
ID: Wisteria21_contig00035405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035405 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013456320.1| hypothetical protein MTR_4g068005 [Medicago ... 59 1e-06 ref|XP_008237410.1| PREDICTED: uncharacterized protein LOC103336... 59 2e-06 >ref|XP_013456320.1| hypothetical protein MTR_4g068005 [Medicago truncatula] gi|657388403|gb|KEH30351.1| hypothetical protein MTR_4g068005 [Medicago truncatula] Length = 648 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 113 MKFCRTDTRSILQQIKRQEKQIKLKRRWLLGLP 15 MKFCRTD SIL+ KRQ+KQIKLKRRWLLGLP Sbjct: 1 MKFCRTDISSILRDAKRQDKQIKLKRRWLLGLP 33 >ref|XP_008237410.1| PREDICTED: uncharacterized protein LOC103336159 [Prunus mume] Length = 665 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 128 QLS*EMKFCRTDTRSILQQIKRQEKQIKLKRRWLLGLPTSKS 3 QL + F +TD S+ QIKRQEKQI+LKRRWLLGLPTSKS Sbjct: 5 QLMENLGFYQTDCESLWSQIKRQEKQIQLKRRWLLGLPTSKS 46