BLASTX nr result
ID: Wisteria21_contig00035307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00035307 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163169.1| hypothetical protein PHAVU_001G212300g [Phas... 57 5e-06 gb|KOM39412.1| hypothetical protein LR48_Vigan03g279400 [Vigna a... 56 9e-06 >ref|XP_007163169.1| hypothetical protein PHAVU_001G212300g [Phaseolus vulgaris] gi|561036633|gb|ESW35163.1| hypothetical protein PHAVU_001G212300g [Phaseolus vulgaris] Length = 165 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 4/45 (8%) Frame = -1 Query: 443 TAKVSPSPVSKLTERDGENEVALFPVRPRL----RWNPVLDPIFE 321 TAKVSPS +S+ ERD ENEV +FPV PRL RWNPVLD I E Sbjct: 121 TAKVSPSLISRSIERDVENEVTVFPVCPRLGNQVRWNPVLDTILE 165 >gb|KOM39412.1| hypothetical protein LR48_Vigan03g279400 [Vigna angularis] Length = 165 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Frame = -1 Query: 440 AKVSPSPVSKLTERDGENEVALFPVRPRL----RWNPVLDPIFE 321 AKVSPS +S+ TERD ENEV + P PRL RWNPVLD IFE Sbjct: 122 AKVSPSLISRSTERDAENEVTVSPACPRLGNQVRWNPVLDTIFE 165