BLASTX nr result
ID: Wisteria21_contig00034853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034853 (576 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH63634.1| hypothetical protein GLYMA_04G188500 [Glycine max] 78 4e-12 >gb|KRH63634.1| hypothetical protein GLYMA_04G188500 [Glycine max] Length = 92 Score = 77.8 bits (190), Expect = 4e-12 Identities = 44/70 (62%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = -1 Query: 396 LSLFLLFVKQFILLKFKNVFYILSQHLPRFQLHLHLCEISLVHLSHHQDSGMLH-LSSSV 220 +SLFLLFV F+LLKF +VFYILSQHLP LHLHL + S HLS QDS H + S Sbjct: 23 VSLFLLFVNHFVLLKFNDVFYILSQHLPCL-LHLHLRDNSRTHLSLEQDSIKWHCMPCST 81 Query: 219 WEASAAEISL 190 WE SAAE+SL Sbjct: 82 WEESAAEVSL 91