BLASTX nr result
ID: Wisteria21_contig00034585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034585 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH47284.1| hypothetical protein GLYMA_07G019800 [Glycine max... 67 4e-09 gb|KRH47283.1| hypothetical protein GLYMA_07G019800 [Glycine max] 67 4e-09 gb|KRH44351.1| hypothetical protein GLYMA_08G204900 [Glycine max] 67 4e-09 gb|KRH44350.1| hypothetical protein GLYMA_08G204900 [Glycine max] 67 4e-09 gb|KHN47824.1| Rho guanine nucleotide exchange factor 8 [Glycine... 67 4e-09 ref|XP_003530166.1| PREDICTED: rop guanine nucleotide exchange f... 67 4e-09 ref|XP_014516174.1| PREDICTED: rop guanine nucleotide exchange f... 66 9e-09 gb|KOM27362.1| hypothetical protein LR48_Vigan406s017200 [Vigna ... 66 9e-09 ref|XP_007135675.1| hypothetical protein PHAVU_010G148900g [Phas... 66 1e-08 >gb|KRH47284.1| hypothetical protein GLYMA_07G019800 [Glycine max] gi|947098793|gb|KRH47285.1| hypothetical protein GLYMA_07G019800 [Glycine max] Length = 399 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 367 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 399 >gb|KRH47283.1| hypothetical protein GLYMA_07G019800 [Glycine max] Length = 446 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 414 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 446 >gb|KRH44351.1| hypothetical protein GLYMA_08G204900 [Glycine max] Length = 447 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 415 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 447 >gb|KRH44350.1| hypothetical protein GLYMA_08G204900 [Glycine max] Length = 454 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 422 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 454 >gb|KHN47824.1| Rho guanine nucleotide exchange factor 8 [Glycine soja] Length = 539 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 507 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 539 >ref|XP_003530166.1| PREDICTED: rop guanine nucleotide exchange factor 12-like [Glycine max] gi|734321549|gb|KHN04210.1| Rho guanine nucleotide exchange factor 8 [Glycine soja] gi|947098790|gb|KRH47282.1| hypothetical protein GLYMA_07G019800 [Glycine max] Length = 538 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP++VTDKKVSYLETLGGMRSPTSRH Sbjct: 506 DNGKPQKLPNVVTDKKVSYLETLGGMRSPTSRH 538 >ref|XP_014516174.1| PREDICTED: rop guanine nucleotide exchange factor 12-like [Vigna radiata var. radiata] Length = 534 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP IVTDKKVSYLETLGGMRSPT+RH Sbjct: 502 DNGKPQKLPEIVTDKKVSYLETLGGMRSPTARH 534 >gb|KOM27362.1| hypothetical protein LR48_Vigan406s017200 [Vigna angularis] Length = 536 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP IVTDKKVSYLETLGGMRSPT+RH Sbjct: 504 DNGKPQKLPDIVTDKKVSYLETLGGMRSPTARH 536 >ref|XP_007135675.1| hypothetical protein PHAVU_010G148900g [Phaseolus vulgaris] gi|561008720|gb|ESW07669.1| hypothetical protein PHAVU_010G148900g [Phaseolus vulgaris] Length = 533 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 386 DSGKPQKLPSIVTDKKVSYLETLGGMRSPTSRH 288 D+GKPQKLP +VTDKKVSYLETLGGMRSPT+RH Sbjct: 501 DNGKPQKLPDVVTDKKVSYLETLGGMRSPTARH 533