BLASTX nr result
ID: Wisteria21_contig00034548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034548 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623067.2| PPR containing plant-like protein, putative ... 128 1e-27 ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containi... 126 7e-27 ref|XP_010659686.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 emb|CBI39576.3| unnamed protein product [Vitis vinifera] 103 4e-20 emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] 103 4e-20 ref|XP_008806365.1| PREDICTED: pentatricopeptide repeat-containi... 100 7e-19 ref|XP_010108947.1| hypothetical protein L484_027142 [Morus nota... 99 1e-18 ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phas... 99 1e-18 ref|XP_008450076.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_002523294.1| pentatricopeptide repeat-containing protein,... 98 2e-18 ref|XP_007051476.1| Pentatricopeptide repeat (PPR-like) superfam... 98 2e-18 ref|XP_010934489.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containi... 97 6e-18 gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna a... 97 6e-18 ref|XP_010054979.1| PREDICTED: pentatricopeptide repeat-containi... 97 6e-18 gb|KCW71467.1| hypothetical protein EUGRSUZ_E00027 [Eucalyptus g... 97 6e-18 gb|KDO86555.1| hypothetical protein CISIN_1g043284mg [Citrus sin... 96 1e-17 ref|XP_006491330.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_006444781.1| hypothetical protein CICLE_v10024306mg [Citr... 96 1e-17 ref|XP_009416895.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 >ref|XP_003623067.2| PPR containing plant-like protein, putative [Medicago truncatula] gi|657378065|gb|AES79285.2| PPR containing plant-like protein, putative [Medicago truncatula] Length = 535 Score = 128 bits (322), Expect = 1e-27 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 218 GYGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVS 39 GYGLAG+P+RAL+TFLRIESFGIRPSVRS+NALLNSLVQ+KRYRLA LVFKNCG RF V Sbjct: 129 GYGLAGKPVRALKTFLRIESFGIRPSVRSINALLNSLVQNKRYRLAFLVFKNCGERFRVL 188 Query: 38 PNVVSCNILLKA 3 PNVVSCNILLKA Sbjct: 189 PNVVSCNILLKA 200 >ref|XP_004492340.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cicer arietinum] Length = 545 Score = 126 bits (316), Expect = 7e-27 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -3 Query: 218 GYGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVS 39 GYGLAG+P+RALRTFLRIESFGIRPSVRSLNALLNSLVQ+KRYRLA LVFKN RFGV Sbjct: 137 GYGLAGKPVRALRTFLRIESFGIRPSVRSLNALLNSLVQNKRYRLAFLVFKNSRDRFGVL 196 Query: 38 PNVVSCNILLKA 3 PNVVSCNILLKA Sbjct: 197 PNVVSCNILLKA 208 >ref|XP_010659686.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial isoform X1 [Vitis vinifera] gi|731415835|ref|XP_010659687.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial isoform X1 [Vitis vinifera] Length = 565 Score = 103 bits (258), Expect = 4e-20 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YG AGRP A+RTFLRI SFG++PSVRS N LLN+LVQ+KR+ L HL+FKNC +FG+ P Sbjct: 159 YGFAGRPKLAIRTFLRIPSFGLQPSVRSFNTLLNTLVQNKRFDLVHLMFKNCRKKFGIVP 218 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 219 NVFTCNILVKA 229 >emb|CBI39576.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 103 bits (258), Expect = 4e-20 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YG AGRP A+RTFLRI SFG++PSVRS N LLN+LVQ+KR+ L HL+FKNC +FG+ P Sbjct: 180 YGFAGRPKLAIRTFLRIPSFGLQPSVRSFNTLLNTLVQNKRFDLVHLMFKNCRKKFGIVP 239 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 240 NVFTCNILVKA 250 >emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] Length = 844 Score = 103 bits (258), Expect = 4e-20 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YG AGRP A+RTFLRI SFG++PSVRS N LLN+LVQ+KR+ L HL+FKNC +FG+ P Sbjct: 180 YGFAGRPKLAIRTFLRIPSFGLQPSVRSFNTLLNTLVQNKRFDLVHLMFKNCRKKFGIVP 239 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 240 NVFTCNILVKA 250 >ref|XP_008806365.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Phoenix dactylifera] Length = 559 Score = 99.8 bits (247), Expect = 7e-19 Identities = 48/71 (67%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 Y LA RP ALRTFL I SFG+R SVRS NALLN+++Q++RYRLA +F+ C +RFGV P Sbjct: 156 YSLASRPAAALRTFLSIPSFGVRASVRSFNALLNAMIQNRRYRLAAALFRRCRSRFGVIP 215 Query: 35 NVVSCNILLKA 3 NV SCNILLKA Sbjct: 216 NVCSCNILLKA 226 >ref|XP_010108947.1| hypothetical protein L484_027142 [Morus notabilis] gi|587933624|gb|EXC20587.1| hypothetical protein L484_027142 [Morus notabilis] Length = 531 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/71 (66%), Positives = 60/71 (84%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAGRP +L+TFLRI++FG++ SVRSLN LLN+LVQ+KRY L VF+NC ++FGV P Sbjct: 130 YGLAGRPKWSLKTFLRIQNFGVQCSVRSLNCLLNALVQNKRYDLVRWVFENCQSKFGVVP 189 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 190 NVFTCNILIKA 200 >ref|XP_007140308.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] gi|561013441|gb|ESW12302.1| hypothetical protein PHAVU_008G101200g [Phaseolus vulgaris] Length = 534 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/71 (64%), Positives = 60/71 (84%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P+ A+R FL+ +S ++PS++SLNALLN+LVQ+KRYRLAH +FK+ +F V P Sbjct: 131 YGLAGKPLSAVRLFLKFQSLRVQPSIKSLNALLNALVQNKRYRLAHSLFKSSAEKFRVVP 190 Query: 35 NVVSCNILLKA 3 NVVSCNILLKA Sbjct: 191 NVVSCNILLKA 201 >ref|XP_008450076.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cucumis melo] gi|659098313|ref|XP_008450077.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cucumis melo] Length = 535 Score = 98.6 bits (244), Expect = 2e-18 Identities = 47/71 (66%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAGRP AL+TFLRI++FG+R SVRSLN LLN+LVQ+ R+ L HL+FK ++FGV P Sbjct: 131 YGLAGRPKMALKTFLRIQTFGVRRSVRSLNTLLNALVQNNRFSLVHLLFKYSKSKFGVVP 190 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 191 NVFTCNILIKA 201 >ref|XP_002523294.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537382|gb|EEF39010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 544 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/71 (63%), Positives = 58/71 (81%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P ALRTF+RI+ F ++ SVRSLN LLN+ VQ+KRY L H +FKNC +++GV P Sbjct: 140 YGLAGKPDFALRTFIRIQDFNVQRSVRSLNTLLNAFVQNKRYDLVHAMFKNCRSKYGVLP 199 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 200 NVFTCNILIKA 210 >ref|XP_007051476.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508703737|gb|EOX95633.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 545 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/71 (66%), Positives = 58/71 (81%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLA RP AL+TFLRIE+F ++ SVRSLN LLN+LVQ+KRY L H++FKN +FGV P Sbjct: 137 YGLASRPKLALKTFLRIENFNVQRSVRSLNTLLNALVQNKRYDLVHIMFKNSKTKFGVVP 196 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 197 NVFTCNILIKA 207 >ref|XP_010934489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Elaeis guineensis] Length = 554 Score = 97.1 bits (240), Expect = 5e-18 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 Y LA RP ALRTFL I SFG+R SVRS NALLN+++Q++RYRLA +F+ C +RFG+ P Sbjct: 151 YSLASRPAAALRTFLSIPSFGVRASVRSFNALLNAMIQNQRYRLAAALFRCCRSRFGIIP 210 Query: 35 NVVSCNILLKA 3 NV SCNIL+KA Sbjct: 211 NVCSCNILIKA 221 >ref|XP_014517015.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] gi|951037854|ref|XP_014517016.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vigna radiata var. radiata] Length = 534 Score = 96.7 bits (239), Expect = 6e-18 Identities = 46/71 (64%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P+ A+R FL+++ +R SV+SLNALLN+LVQ+KRY LAH VFK+ +FGV P Sbjct: 131 YGLAGKPLSAVRLFLKLQPLRVRTSVKSLNALLNALVQNKRYSLAHSVFKSSAEKFGVVP 190 Query: 35 NVVSCNILLKA 3 +VVSCNILLKA Sbjct: 191 DVVSCNILLKA 201 >gb|KOM37994.1| hypothetical protein LR48_Vigan03g137600 [Vigna angularis] Length = 534 Score = 96.7 bits (239), Expect = 6e-18 Identities = 46/71 (64%), Positives = 59/71 (83%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P+ A+R FL+++ +R SV+SLNALLN+LVQ+KRY LAH VFK+ +FGV P Sbjct: 131 YGLAGKPLSAVRLFLKLQPLRVRTSVKSLNALLNALVQNKRYSLAHSVFKSSAEKFGVVP 190 Query: 35 NVVSCNILLKA 3 +VVSCNILLKA Sbjct: 191 DVVSCNILLKA 201 >ref|XP_010054979.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Eucalyptus grandis] Length = 542 Score = 96.7 bits (239), Expect = 6e-18 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P ALRTFL I+ FG++ SVRSLN LLN+LVQ+KR+ L H +FKN +FGV P Sbjct: 137 YGLAGKPRLALRTFLGIDGFGVQRSVRSLNTLLNALVQNKRFDLVHTIFKNSKTKFGVVP 196 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 197 NVFTCNILIKA 207 >gb|KCW71467.1| hypothetical protein EUGRSUZ_E00027 [Eucalyptus grandis] Length = 530 Score = 96.7 bits (239), Expect = 6e-18 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAG+P ALRTFL I+ FG++ SVRSLN LLN+LVQ+KR+ L H +FKN +FGV P Sbjct: 137 YGLAGKPRLALRTFLGIDGFGVQRSVRSLNTLLNALVQNKRFDLVHTIFKNSKTKFGVVP 196 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 197 NVFTCNILIKA 207 >gb|KDO86555.1| hypothetical protein CISIN_1g043284mg [Citrus sinensis] Length = 527 Score = 95.9 bits (237), Expect = 1e-17 Identities = 47/71 (66%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAGRP A++TFLRIE F ++ SVRSLN LLN+LVQ+KRY L HL+FKN +F V P Sbjct: 124 YGLAGRPELAVKTFLRIEKFNVQRSVRSLNTLLNALVQNKRYDLVHLMFKNSRHKFKVVP 183 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 184 NVFTCNILIKA 194 >ref|XP_006491330.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Citrus sinensis] Length = 571 Score = 95.9 bits (237), Expect = 1e-17 Identities = 47/71 (66%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAGRP A++TFLRIE F ++ SVRSLN LLN+LVQ+KRY L HL+FKN +F V P Sbjct: 168 YGLAGRPELAVKTFLRIEKFNVQRSVRSLNTLLNALVQNKRYDLVHLMFKNSRHKFKVVP 227 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 228 NVFTCNILIKA 238 >ref|XP_006444781.1| hypothetical protein CICLE_v10024306mg [Citrus clementina] gi|557547043|gb|ESR58021.1| hypothetical protein CICLE_v10024306mg [Citrus clementina] Length = 537 Score = 95.9 bits (237), Expect = 1e-17 Identities = 47/71 (66%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 YGLAGRP A++TFLRIE F ++ SVRSLN LLN+LVQ+KRY L HL+FKN +F V P Sbjct: 124 YGLAGRPELAVKTFLRIEKFNVQRSVRSLNTLLNALVQNKRYDLVHLMFKNSRHKFKVVP 183 Query: 35 NVVSCNILLKA 3 NV +CNIL+KA Sbjct: 184 NVFTCNILIKA 194 >ref|XP_009416895.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Musa acuminata subsp. malaccensis] Length = 547 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/71 (63%), Positives = 57/71 (80%) Frame = -3 Query: 215 YGLAGRPIRALRTFLRIESFGIRPSVRSLNALLNSLVQSKRYRLAHLVFKNCGARFGVSP 36 Y LA RP ALR+FL I SFG+RPSVRS NALLN++VQ++R L L+F+NC ++FG+ P Sbjct: 144 YSLASRPAAALRSFLSIPSFGLRPSVRSFNALLNAMVQNRRLDLVALLFRNCRSKFGIIP 203 Query: 35 NVVSCNILLKA 3 NV +CNILLKA Sbjct: 204 NVCTCNILLKA 214