BLASTX nr result
ID: Wisteria21_contig00034240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034240 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009341965.1| PREDICTED: probable auxin efflux carrier com... 81 3e-13 ref|XP_014491393.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_014512525.1| PREDICTED: auxin efflux carrier component 1-... 79 1e-12 ref|XP_010112842.1| putative auxin efflux carrier component 1c [... 79 1e-12 gb|AJI44019.1| auxin efflux carrier component 1 sister [Agave te... 79 1e-12 ref|XP_012088553.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_012088551.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_012088550.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 gb|KJB46196.1| hypothetical protein B456_007G352200 [Gossypium r... 79 1e-12 ref|XP_012434876.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 gb|AIW04421.1| PIN1-like auxin transport protein PIN1 [Betula lu... 79 1e-12 ref|XP_011072996.1| PREDICTED: auxin efflux carrier component 1-... 79 1e-12 ref|XP_011000408.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_011040757.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_010922067.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 gb|KHN30345.1| Auxin efflux carrier component 1 [Glycine soja] 79 1e-12 gb|KHN08891.1| Putative auxin efflux carrier component 1c [Glyci... 79 1e-12 gb|KHN00146.1| Auxin efflux carrier component 1 [Glycine soja] 79 1e-12 ref|XP_010678065.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 ref|XP_010246173.1| PREDICTED: probable auxin efflux carrier com... 79 1e-12 >ref|XP_009341965.1| PREDICTED: probable auxin efflux carrier component 1b [Pyrus x bretschneideri] Length = 617 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HPNILSTGVIFGMLIALPITLVYYILLGL Sbjct: 579 PFVFAKEYNVHPNILSTGVIFGMLIALPITLVYYILLGL 617 >ref|XP_014491393.1| PREDICTED: probable auxin efflux carrier component 1b [Vigna radiata var. radiata] Length = 587 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 549 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 587 >ref|XP_014512525.1| PREDICTED: auxin efflux carrier component 1-like [Vigna radiata var. radiata] Length = 592 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 554 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 592 >ref|XP_010112842.1| putative auxin efflux carrier component 1c [Morus notabilis] gi|587948717|gb|EXC34965.1| putative auxin efflux carrier component 1c [Morus notabilis] Length = 588 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 550 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 588 >gb|AJI44019.1| auxin efflux carrier component 1 sister [Agave tequilana] Length = 599 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 561 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 599 >ref|XP_012088553.1| PREDICTED: probable auxin efflux carrier component 1c isoform X3 [Jatropha curcas] Length = 614 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 576 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 614 >ref|XP_012088551.1| PREDICTED: probable auxin efflux carrier component 1c isoform X2 [Jatropha curcas] Length = 615 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 577 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 615 >ref|XP_012088550.1| PREDICTED: probable auxin efflux carrier component 1c isoform X1 [Jatropha curcas] Length = 617 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 579 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 617 >gb|KJB46196.1| hypothetical protein B456_007G352200 [Gossypium raimondii] Length = 576 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 538 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 576 >ref|XP_012434876.1| PREDICTED: probable auxin efflux carrier component 1c [Gossypium raimondii] gi|763779071|gb|KJB46194.1| hypothetical protein B456_007G352200 [Gossypium raimondii] Length = 585 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 547 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 585 >gb|AIW04421.1| PIN1-like auxin transport protein PIN1 [Betula luminifera] Length = 609 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 569 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 607 >ref|XP_011072996.1| PREDICTED: auxin efflux carrier component 1-like [Sesamum indicum] Length = 586 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 548 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 586 >ref|XP_011000408.1| PREDICTED: probable auxin efflux carrier component 1b [Populus euphratica] Length = 588 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 550 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 588 >ref|XP_011040757.1| PREDICTED: probable auxin efflux carrier component 1b [Populus euphratica] Length = 591 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 553 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 591 >ref|XP_010922067.1| PREDICTED: probable auxin efflux carrier component 1b [Elaeis guineensis] Length = 602 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 564 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 602 >gb|KHN30345.1| Auxin efflux carrier component 1 [Glycine soja] Length = 595 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 557 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 595 >gb|KHN08891.1| Putative auxin efflux carrier component 1c [Glycine soja] Length = 594 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 556 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 594 >gb|KHN00146.1| Auxin efflux carrier component 1 [Glycine soja] Length = 601 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 563 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 601 >ref|XP_010678065.1| PREDICTED: probable auxin efflux carrier component 1c [Beta vulgaris subsp. vulgaris] gi|870859641|gb|KMT11044.1| hypothetical protein BVRB_5g111350 [Beta vulgaris subsp. vulgaris] Length = 619 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 581 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 619 >ref|XP_010246173.1| PREDICTED: probable auxin efflux carrier component 1b isoform X2 [Nelumbo nucifera] Length = 588 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 310 PFVFAKEYNIHPNILSTGVIFGMLIALPITLVYYILLGL 194 PFVFAKEYN+HP+ILSTGVIFGMLIALPITLVYYILLGL Sbjct: 550 PFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 588