BLASTX nr result
ID: Wisteria21_contig00034078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00034078 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH18489.1| hypothetical protein GLYMA_13G063900 [Glycine max] 69 1e-09 >gb|KRH18489.1| hypothetical protein GLYMA_13G063900 [Glycine max] Length = 192 Score = 69.3 bits (168), Expect = 1e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 213 DQILVERKGFAFFVDIEYERLPTFCSACKIIGHPLENCRK 94 DQIL ER G+AFFVD+ YERLP+FCS+CKI+GH E+C+K Sbjct: 80 DQILFERAGYAFFVDVVYERLPSFCSSCKIVGHSFESCKK 119