BLASTX nr result
ID: Wisteria21_contig00033950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033950 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH31255.1| hypothetical protein GLYMA_11G237400 [Glycine max] 64 6e-08 ref|XP_003537505.1| PREDICTED: uncharacterized protein LOC100815... 64 6e-08 gb|KNA06982.1| hypothetical protein SOVF_175260 [Spinacia oleracea] 62 1e-07 ref|XP_012075173.1| PREDICTED: UPF0400 protein C337.03 isoform X... 62 1e-07 ref|XP_012075171.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_011097607.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 gb|KHN38205.1| Regulation of nuclear pre-mRNA domain-containing ... 62 1e-07 gb|KHN29096.1| Regulation of nuclear pre-mRNA domain-containing ... 62 1e-07 ref|XP_010680597.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_011653130.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_009415499.1| PREDICTED: TOX high mobility group box famil... 62 1e-07 ref|XP_009415496.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_009342063.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_008453770.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_008374316.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_008374315.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_008245134.1| PREDICTED: regulation of nuclear pre-mRNA do... 62 1e-07 ref|XP_010027793.1| PREDICTED: stress response protein NST1 [Euc... 62 1e-07 emb|CBI21475.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002276726.1| PREDICTED: CID domain-containing protein 1 [... 62 1e-07 >gb|KRH31255.1| hypothetical protein GLYMA_11G237400 [Glycine max] Length = 487 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MNGVFSEQILADKLSKLN+TQQCIETLSHW Sbjct: 1 MNGVFSEQILADKLSKLNNTQQCIETLSHW 30 >ref|XP_003537505.1| PREDICTED: uncharacterized protein LOC100815709 [Glycine max] gi|947082465|gb|KRH31254.1| hypothetical protein GLYMA_11G237400 [Glycine max] Length = 552 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MNGVFSEQILADKLSKLN+TQQCIETLSHW Sbjct: 1 MNGVFSEQILADKLSKLNNTQQCIETLSHW 30 >gb|KNA06982.1| hypothetical protein SOVF_175260 [Spinacia oleracea] Length = 521 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_012075173.1| PREDICTED: UPF0400 protein C337.03 isoform X2 [Jatropha curcas] Length = 425 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_012075171.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2 isoform X1 [Jatropha curcas] Length = 525 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_011097607.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B-like [Sesamum indicum] Length = 525 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >gb|KHN38205.1| Regulation of nuclear pre-mRNA domain-containing protein 1B [Glycine soja] Length = 515 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >gb|KHN29096.1| Regulation of nuclear pre-mRNA domain-containing protein 1B [Glycine soja] Length = 498 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_010680597.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A [Beta vulgaris subsp. vulgaris] Length = 498 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_011653130.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B-like [Cucumis sativus] gi|700198076|gb|KGN53234.1| hypothetical protein Csa_4G031050 [Cucumis sativus] Length = 525 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_009415499.1| PREDICTED: TOX high mobility group box family member 4-A-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 517 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_009415496.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Musa acuminata subsp. malaccensis] gi|695054717|ref|XP_009415497.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Musa acuminata subsp. malaccensis] gi|695054719|ref|XP_009415498.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 546 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_009342063.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A [Pyrus x bretschneideri] Length = 518 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_008453770.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B [Cucumis melo] Length = 525 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_008374316.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A isoform X2 [Malus domestica] Length = 404 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_008374315.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1A isoform X1 [Malus domestica] Length = 518 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_008245134.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 1B [Prunus mume] Length = 521 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_010027793.1| PREDICTED: stress response protein NST1 [Eucalyptus grandis] gi|629088144|gb|KCW54397.1| hypothetical protein EUGRSUZ_I00350 [Eucalyptus grandis] gi|629088145|gb|KCW54398.1| hypothetical protein EUGRSUZ_I00350 [Eucalyptus grandis] Length = 552 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 40 MNSVFSEQILADKLSKLNSTQQCIETLSHW 69 >emb|CBI21475.3| unnamed protein product [Vitis vinifera] Length = 473 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30 >ref|XP_002276726.1| PREDICTED: CID domain-containing protein 1 [Vitis vinifera] Length = 524 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 174 MNGVFSEQILADKLSKLNSTQQCIETLSHW 263 MN VFSEQILADKLSKLNSTQQCIETLSHW Sbjct: 1 MNSVFSEQILADKLSKLNSTQQCIETLSHW 30