BLASTX nr result
ID: Wisteria21_contig00033768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033768 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538827.1| PREDICTED: vegetative incompatibility protei... 150 3e-34 ref|XP_007156854.1| hypothetical protein PHAVU_002G023100g [Phas... 150 4e-34 ref|XP_003611846.1| transducin/WD40 repeat protein [Medicago tru... 147 4e-33 ref|XP_003517270.2| PREDICTED: vegetative incompatibility protei... 146 7e-33 gb|KOM45071.1| hypothetical protein LR48_Vigan06g037700 [Vigna a... 144 2e-32 ref|XP_004511983.1| PREDICTED: WD repeat-containing protein 5 ho... 144 3e-32 ref|XP_014520488.1| PREDICTED: E3 ubiquitin-protein ligase TRAF7... 142 1e-31 ref|XP_011025972.1| PREDICTED: myosin heavy chain kinase B-like ... 125 1e-26 ref|XP_002310768.2| hypothetical protein POPTR_0007s11930g, part... 122 8e-26 ref|XP_002306446.2| transducin family protein, partial [Populus ... 120 4e-25 gb|KDO79386.1| hypothetical protein CISIN_1g047728mg [Citrus sin... 120 5e-25 ref|XP_006466745.1| PREDICTED: vegetative incompatibility protei... 120 5e-25 ref|XP_006425796.1| hypothetical protein CICLE_v10027384mg [Citr... 120 5e-25 emb|CDP07591.1| unnamed protein product [Coffea canephora] 117 3e-24 ref|XP_002522373.1| F-box and wd40 domain protein, putative [Ric... 117 4e-24 ref|XP_010999588.1| PREDICTED: F-box/WD repeat-containing protei... 115 1e-23 ref|XP_007047105.1| Transducin/WD40 repeat-like superfamily prot... 115 1e-23 ref|XP_012450445.1| PREDICTED: myosin heavy chain kinase B-like ... 115 1e-23 ref|XP_008457956.1| PREDICTED: WD repeat-containing protein 5-li... 115 1e-23 ref|XP_011004613.1| PREDICTED: myosin heavy chain kinase B [Popu... 115 2e-23 >ref|XP_003538827.1| PREDICTED: vegetative incompatibility protein HET-E-1-like [Glycine max] gi|947079751|gb|KRH28540.1| hypothetical protein GLYMA_11G060400 [Glycine max] Length = 458 Score = 150 bits (380), Expect = 3e-34 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 1/91 (1%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSLVFSGSADMAICVWKRS +N++HTC+++LSGHTGPVKCLAAERDP+AM NERRWILYS Sbjct: 353 GSLVFSGSADMAICVWKRS-LNDDHTCVNILSGHTGPVKCLAAERDPEAMCNERRWILYS 411 Query: 90 GSLDKSVKVWRVSENAAPA-QHHNQPRLSVD 1 GSLDKSVKVW+VSENAA A +H PR S+D Sbjct: 412 GSLDKSVKVWKVSENAASAHNNHQPPRPSLD 442 >ref|XP_007156854.1| hypothetical protein PHAVU_002G023100g [Phaseolus vulgaris] gi|561030269|gb|ESW28848.1| hypothetical protein PHAVU_002G023100g [Phaseolus vulgaris] Length = 457 Score = 150 bits (379), Expect = 4e-34 Identities = 70/90 (77%), Positives = 80/90 (88%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSADM+ICVWKRS ++ EHTC+ VLSGH GPVKCLAAERDPDAM NERRWILYS Sbjct: 352 GNLVFSGSADMSICVWKRS-LSEEHTCVHVLSGHAGPVKCLAAERDPDAMCNERRWILYS 410 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQPRLSVD 1 GSLDKSVK+W+VSE+A P +H P+LSVD Sbjct: 411 GSLDKSVKMWKVSEHATPQNNHQPPKLSVD 440 >ref|XP_003611846.1| transducin/WD40 repeat protein [Medicago truncatula] gi|355513181|gb|AES94804.1| transducin/WD40 repeat protein [Medicago truncatula] Length = 457 Score = 147 bits (370), Expect = 4e-33 Identities = 73/91 (80%), Positives = 78/91 (85%), Gaps = 2/91 (2%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSLVFSGSADMAICVWKRS + NEH CMSVLSGHTGPVKCLAAE+D D ML+ER+WILYS Sbjct: 349 GSLVFSGSADMAICVWKRS-ITNEHVCMSVLSGHTGPVKCLAAEKDLDVMLHERKWILYS 407 Query: 90 GSLDKSVKVWRVSENAAPAQ--HHNQPRLSV 4 GSLDKSVKVW+V ENA P Q H PRLSV Sbjct: 408 GSLDKSVKVWKVKENAPPGQQTHQQAPRLSV 438 >ref|XP_003517270.2| PREDICTED: vegetative incompatibility protein HET-E-1-like [Glycine max] gi|734411803|gb|KHN36189.1| Myosin heavy chain kinase B [Glycine soja] gi|947129071|gb|KRH76925.1| hypothetical protein GLYMA_01G182100 [Glycine max] Length = 460 Score = 146 bits (368), Expect = 7e-33 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 3/93 (3%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSLVFSGSADMAICVWKR+ ++ EHTC+ +LSGHTGPVKCLAAE+DP+AM NERRWILYS Sbjct: 353 GSLVFSGSADMAICVWKRT-LSEEHTCVKILSGHTGPVKCLAAEKDPEAMCNERRWILYS 411 Query: 90 GSLDKSVKVWRVSEN---AAPAQHHNQPRLSVD 1 GSLDKSVKVW+VSEN A +H PRLSVD Sbjct: 412 GSLDKSVKVWKVSENINAGAQNNNHQPPRLSVD 444 >gb|KOM45071.1| hypothetical protein LR48_Vigan06g037700 [Vigna angularis] Length = 452 Score = 144 bits (364), Expect = 2e-32 Identities = 69/90 (76%), Positives = 77/90 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSLVFSGSADM+ICVWKRS ++ EHTC++VLSGH GPVKCLAAERD D M NERRWILYS Sbjct: 348 GSLVFSGSADMSICVWKRS-LSQEHTCLNVLSGHCGPVKCLAAERDLDGMCNERRWILYS 406 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQPRLSVD 1 GSLDKSVK+W+VSENA +H PR SVD Sbjct: 407 GSLDKSVKMWKVSENATAQHNHQAPRQSVD 436 >ref|XP_004511983.1| PREDICTED: WD repeat-containing protein 5 homolog [Cicer arietinum] Length = 463 Score = 144 bits (363), Expect = 3e-32 Identities = 71/92 (77%), Positives = 79/92 (85%), Gaps = 4/92 (4%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSL+FSGSADMAICVWK+S ++NEH CMSVLSGHTGPVKCLAAE+DPDAM NERRWILYS Sbjct: 356 GSLLFSGSADMAICVWKKS-ISNEHVCMSVLSGHTGPVKCLAAEKDPDAMCNERRWILYS 414 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQ----PRLS 7 GSLDKSVKVW+VSE+ Q +N PRLS Sbjct: 415 GSLDKSVKVWKVSESGPTGQQNNNHPPPPRLS 446 >ref|XP_014520488.1| PREDICTED: E3 ubiquitin-protein ligase TRAF7-like [Vigna radiata var. radiata] Length = 452 Score = 142 bits (358), Expect = 1e-31 Identities = 67/90 (74%), Positives = 77/90 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSL+FSGSADM+ICVWKRS ++ EHTC++VLSGH GPVKCLAAERD D M NERRWILYS Sbjct: 348 GSLIFSGSADMSICVWKRS-LSQEHTCVNVLSGHCGPVKCLAAERDLDGMCNERRWILYS 406 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQPRLSVD 1 GSLDKSVK+W+VSEN+ +H PR SVD Sbjct: 407 GSLDKSVKMWKVSENSTAQHNHQPPRHSVD 436 >ref|XP_011025972.1| PREDICTED: myosin heavy chain kinase B-like [Populus euphratica] Length = 467 Score = 125 bits (315), Expect = 1e-26 Identities = 58/78 (74%), Positives = 68/78 (87%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSL+FSGSADM ICVW+R M N+H C+S+L+GH GPVKCLAAE+D ++ NERRWILYS Sbjct: 356 GSLLFSGSADMGICVWRR--MGNDHICLSLLAGHNGPVKCLAAEKDHESAPNERRWILYS 413 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSENA P Sbjct: 414 GSLDKSVKMWRVSENAPP 431 >ref|XP_002310768.2| hypothetical protein POPTR_0007s11930g, partial [Populus trichocarpa] gi|550334699|gb|EEE91218.2| hypothetical protein POPTR_0007s11930g, partial [Populus trichocarpa] Length = 447 Score = 122 bits (307), Expect = 8e-26 Identities = 57/78 (73%), Positives = 67/78 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSL+FSGSADM ICVW+R M N+H C+S+L+GH GPVKCLAAE+ ++ NERRWILYS Sbjct: 341 GSLLFSGSADMGICVWRR--MGNDHICLSLLAGHKGPVKCLAAEKHHESAPNERRWILYS 398 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSENA P Sbjct: 399 GSLDKSVKMWRVSENAPP 416 >ref|XP_002306446.2| transducin family protein, partial [Populus trichocarpa] gi|550338882|gb|EEE93442.2| transducin family protein, partial [Populus trichocarpa] Length = 343 Score = 120 bits (301), Expect = 4e-25 Identities = 56/78 (71%), Positives = 66/78 (84%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LV SGSADM ICVW+R M +HTC+S+L+GH GPVKCLAAERD ++ N RRWILYS Sbjct: 260 GNLVLSGSADMGICVWRR--MGIDHTCLSLLTGHNGPVKCLAAERDDESASNGRRWILYS 317 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSEN+ P Sbjct: 318 GSLDKSVKMWRVSENSPP 335 >gb|KDO79386.1| hypothetical protein CISIN_1g047728mg [Citrus sinensis] Length = 474 Score = 120 bits (300), Expect = 5e-25 Identities = 53/78 (67%), Positives = 67/78 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSADM+IC+W+R NEH C+S+L+GH+GPVKCLA E+D +++ E+RWILYS Sbjct: 362 GNLVFSGSADMSICIWRRK--ENEHICLSMLTGHSGPVKCLAVEKDDESLSREKRWILYS 419 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSE A P Sbjct: 420 GSLDKSVKMWRVSEQAPP 437 >ref|XP_006466745.1| PREDICTED: vegetative incompatibility protein HET-E-1-like [Citrus sinensis] Length = 441 Score = 120 bits (300), Expect = 5e-25 Identities = 53/78 (67%), Positives = 67/78 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSADM+IC+W+R NEH C+S+L+GH+GPVKCLA E+D +++ E+RWILYS Sbjct: 329 GNLVFSGSADMSICIWRRK--ENEHICLSMLTGHSGPVKCLAVEKDDESLSREKRWILYS 386 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSE A P Sbjct: 387 GSLDKSVKMWRVSEQAPP 404 >ref|XP_006425796.1| hypothetical protein CICLE_v10027384mg [Citrus clementina] gi|557527786|gb|ESR39036.1| hypothetical protein CICLE_v10027384mg [Citrus clementina] Length = 474 Score = 120 bits (300), Expect = 5e-25 Identities = 53/78 (67%), Positives = 67/78 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSADM+IC+W+R NEH C+S+L+GH+GPVKCLA E+D +++ E+RWILYS Sbjct: 362 GNLVFSGSADMSICIWRRK--ENEHICLSMLTGHSGPVKCLAVEKDDESLSREKRWILYS 419 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSE A P Sbjct: 420 GSLDKSVKMWRVSEQAPP 437 >emb|CDP07591.1| unnamed protein product [Coffea canephora] Length = 444 Score = 117 bits (293), Expect = 3e-24 Identities = 54/81 (66%), Positives = 64/81 (79%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSAD ICVW+R N HTC+SVL+GHTGPVKCLAAE D D+ ++RW++YS Sbjct: 345 GNLVFSGSADKTICVWRREG--NVHTCLSVLTGHTGPVKCLAAEEDKDSSTGDQRWVVYS 402 Query: 90 GSLDKSVKVWRVSENAAPAQH 28 GSLDKSVKVW VSE A +H Sbjct: 403 GSLDKSVKVWSVSETAPDLRH 423 >ref|XP_002522373.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223538451|gb|EEF40057.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 462 Score = 117 bits (292), Expect = 4e-24 Identities = 54/78 (69%), Positives = 63/78 (80%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 GSLVFSGSADM ICVW+R + +H C+S+L+GHTGPVKCLA E+D + E RWILYS Sbjct: 355 GSLVFSGSADMGICVWRR--LGADHICLSLLTGHTGPVKCLATEKDQELTSGEARWILYS 412 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSEN P Sbjct: 413 GSLDKSVKMWRVSENTPP 430 >ref|XP_010999588.1| PREDICTED: F-box/WD repeat-containing protein 11-like [Populus euphratica] Length = 455 Score = 115 bits (289), Expect = 1e-23 Identities = 56/88 (63%), Positives = 67/88 (76%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSAD +ICVW+R A HTC+SVL+GH GPVKCLA E D ++ ++ WI+YS Sbjct: 356 GNLVFSGSADKSICVWRREA-GGVHTCLSVLTGHGGPVKCLAVEEDRESDKGDQHWIVYS 414 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQPRLS 7 GSLDKSVKVWRVSENA + PRLS Sbjct: 415 GSLDKSVKVWRVSENAPEWRGDQSPRLS 442 >ref|XP_007047105.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma cacao] gi|508699366|gb|EOX91262.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma cacao] Length = 559 Score = 115 bits (289), Expect = 1e-23 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 1/86 (1%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LV SGSADM I VWKRS +EH C+S+L+GH+GPVKCLA ERD ++ E+RWILYS Sbjct: 447 GNLVISGSADMGISVWKRSG--SEHLCLSMLTGHSGPVKCLAIERDHESASGEKRWILYS 504 Query: 90 GSLDKSVKVWRVSENAAP-AQHHNQP 16 GSLDKSVK+WR+SE A P Q+ +QP Sbjct: 505 GSLDKSVKMWRISERAPPMMQNQHQP 530 >ref|XP_012450445.1| PREDICTED: myosin heavy chain kinase B-like [Gossypium raimondii] gi|763796788|gb|KJB63743.1| hypothetical protein B456_010G014000 [Gossypium raimondii] Length = 460 Score = 115 bits (288), Expect = 1e-23 Identities = 56/76 (73%), Positives = 65/76 (85%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LVFSGSAD ICVW+R N HTC+SVL+GHTGPVKCLA+E+DP++ NE+RWILYS Sbjct: 356 GNLVFSGSADKTICVWRRDG--NIHTCLSVLTGHTGPVKCLASEKDPNS-TNEQRWILYS 412 Query: 90 GSLDKSVKVWRVSENA 43 GSLDKSVKVW VSE A Sbjct: 413 GSLDKSVKVWSVSEYA 428 >ref|XP_008457956.1| PREDICTED: WD repeat-containing protein 5-like [Cucumis melo] Length = 421 Score = 115 bits (288), Expect = 1e-23 Identities = 57/85 (67%), Positives = 66/85 (77%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G L+ SGSADM ICVW+R+A EH C+SVL+GHTGPVKCLA E+D +A ERRWI+YS Sbjct: 307 GRLLLSGSADMGICVWQRTAA--EHICLSVLTGHTGPVKCLAVEKDSEAGEGERRWIVYS 364 Query: 90 GSLDKSVKVWRVSENAAPAQHHNQP 16 GSLDKSVK+WRVSE PA QP Sbjct: 365 GSLDKSVKMWRVSEQ-PPAAFQKQP 388 >ref|XP_011004613.1| PREDICTED: myosin heavy chain kinase B [Populus euphratica] Length = 468 Score = 115 bits (287), Expect = 2e-23 Identities = 54/78 (69%), Positives = 64/78 (82%) Frame = -1 Query: 270 GSLVFSGSADMAICVWKRSAMNNEHTCMSVLSGHTGPVKCLAAERDPDAMLNERRWILYS 91 G+LV SGSADM ICVW+R M +H C+S+L+GH GPVKCLAAERD + + RRWILYS Sbjct: 358 GNLVLSGSADMGICVWRR--MGIDHMCLSLLTGHNGPVKCLAAERDDGSASSGRRWILYS 415 Query: 90 GSLDKSVKVWRVSENAAP 37 GSLDKSVK+WRVSEN+ P Sbjct: 416 GSLDKSVKMWRVSENSPP 433