BLASTX nr result
ID: Wisteria21_contig00033696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033696 (346 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494707.1| PREDICTED: uncharacterized protein LOC101504... 58 3e-06 ref|XP_010025000.1| PREDICTED: uncharacterized protein LOC104415... 57 5e-06 gb|KCW61580.1| hypothetical protein EUGRSUZ_H04317 [Eucalyptus g... 57 5e-06 ref|XP_013450536.1| FAD/NAD(P)-binding oxidoreductase family pro... 56 9e-06 >ref|XP_004494707.1| PREDICTED: uncharacterized protein LOC101504355 [Cicer arietinum] Length = 478 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 YGTSRRSILKKTFNQEQVTFTAPFSDDPVV 3 YGTSRRSILKK+FNQEQV FTAPFSD+P+V Sbjct: 49 YGTSRRSILKKSFNQEQVNFTAPFSDEPLV 78 >ref|XP_010025000.1| PREDICTED: uncharacterized protein LOC104415418 [Eucalyptus grandis] Length = 495 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 YGTSRRSILKKTFNQEQVTFTAPFSDDPVV 3 YGTSRRSILKKTFNQEQV FTAP DDP+V Sbjct: 68 YGTSRRSILKKTFNQEQVDFTAPIPDDPIV 97 >gb|KCW61580.1| hypothetical protein EUGRSUZ_H04317 [Eucalyptus grandis] Length = 443 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 YGTSRRSILKKTFNQEQVTFTAPFSDDPVV 3 YGTSRRSILKKTFNQEQV FTAP DDP+V Sbjct: 16 YGTSRRSILKKTFNQEQVDFTAPIPDDPIV 45 >ref|XP_013450536.1| FAD/NAD(P)-binding oxidoreductase family protein [Medicago truncatula] gi|657380421|gb|KEH24564.1| FAD/NAD(P)-binding oxidoreductase family protein [Medicago truncatula] Length = 867 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 92 YGTSRRSILKKTFNQEQVTFTAPFSDDPVV 3 YGTSR+SILKKTF QEQVTFTAPFSD+P V Sbjct: 439 YGTSRKSILKKTFKQEQVTFTAPFSDEPHV 468