BLASTX nr result
ID: Wisteria21_contig00033605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033605 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB87055.1| putative serine-rich protein [Escobaria virus] 60 5e-07 >gb|AHB87055.1| putative serine-rich protein [Escobaria virus] Length = 311 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 172 TLLSNTPSGEYAIRTETLPLEELYGLINAVHANNLTWHKHTESLLNAT 29 TLLSNTPS +A+ T LPL ELYGL +A+HAN + W KH E L+ ++ Sbjct: 139 TLLSNTPSQRHAVATGQLPLNELYGLQHALHANTIEWFKHVEHLITSS 186