BLASTX nr result
ID: Wisteria21_contig00033583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033583 (230 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007155559.1| hypothetical protein PHAVU_003G212100g [Phas... 75 2e-11 >ref|XP_007155559.1| hypothetical protein PHAVU_003G212100g [Phaseolus vulgaris] gi|561028913|gb|ESW27553.1| hypothetical protein PHAVU_003G212100g [Phaseolus vulgaris] Length = 69 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/64 (65%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +1 Query: 40 KVLSEVGFLGFASPVA-MTNLFNLSTANMGFNISQDFFCHKFQGVCFYXXXXXXHKLKTT 216 KV SEVGFL FASP A M +LFN+STANM F ISQDFFC +FQGVCF KL+TT Sbjct: 3 KVHSEVGFLAFASPAAAMMDLFNVSTANMPFTISQDFFCREFQGVCF-CFSSLLSKLQTT 61 Query: 217 QHFL 228 FL Sbjct: 62 SLFL 65