BLASTX nr result
ID: Wisteria21_contig00033541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033541 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO56853.1| hypothetical protein CISIN_1g023810mg [Citrus sin... 59 1e-06 ref|XP_006422081.1| hypothetical protein CICLE_v10005598mg [Citr... 59 1e-06 ref|XP_010519178.1| PREDICTED: uncharacterized protein LOC104798... 58 3e-06 >gb|KDO56853.1| hypothetical protein CISIN_1g023810mg [Citrus sinensis] Length = 277 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 279 LKLKRPSGRPHGWVDVRVIVRNTGYGAPRAYDAPAYGVQPT 157 LKLKRPSGRPHG VDV+V VR + Y P AY P YGV P+ Sbjct: 114 LKLKRPSGRPHGKVDVKVAVRESRYAPPGAYHTPPYGVPPS 154 >ref|XP_006422081.1| hypothetical protein CICLE_v10005598mg [Citrus clementina] gi|557523954|gb|ESR35321.1| hypothetical protein CICLE_v10005598mg [Citrus clementina] Length = 277 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 279 LKLKRPSGRPHGWVDVRVIVRNTGYGAPRAYDAPAYGVQPT 157 LKLKRPSGRPHG VDV+V VR + Y P AY P YGV P+ Sbjct: 114 LKLKRPSGRPHGKVDVKVAVRESRYSPPGAYHTPPYGVPPS 154 >ref|XP_010519178.1| PREDICTED: uncharacterized protein LOC104798699 [Tarenaya hassleriana] Length = 274 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 279 LKLKRPSGRPHGWVDVRVIVRNTGYGAPRAYDAPAYG 169 LKLKRPSGRPHG +DV V VR++ Y APR+Y AP+YG Sbjct: 117 LKLKRPSGRPHGKLDVTVTVRDSRYPAPRSYHAPSYG 153