BLASTX nr result
ID: Wisteria21_contig00033384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033384 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442456.1| cytochrome P450 family protein [Medicago tru... 83 7e-14 ref|XP_003625207.1| cytochrome P450 family protein [Medicago tru... 81 3e-13 ref|XP_013445816.1| cytochrome P450 family protein [Medicago tru... 81 3e-13 ref|XP_013442455.1| cytochrome P450 family protein [Medicago tru... 80 6e-13 ref|XP_013445779.1| cytochrome P450 family protein [Medicago tru... 80 8e-13 ref|XP_004497961.2| PREDICTED: cytochrome P450 93A3-like [Cicer ... 79 1e-12 ref|XP_013442420.1| cytochrome P450 family protein [Medicago tru... 77 4e-12 ref|XP_007162289.1| hypothetical protein PHAVU_001G1395000g, par... 76 1e-11 ref|XP_007162282.1| hypothetical protein PHAVU_001G138900g [Phas... 76 1e-11 ref|XP_002277107.2| PREDICTED: cytochrome P450 93A3 [Vitis vinif... 75 1e-11 gb|KHN07406.1| Cytochrome P450 93A3 [Glycine soja] 74 3e-11 ref|XP_012087731.1| PREDICTED: cytochrome P450 93A3-like [Jatrop... 74 3e-11 ref|XP_007028932.1| Cytochrome P450 93A3 [Theobroma cacao] gi|50... 73 7e-11 ref|XP_009797406.1| PREDICTED: cytochrome P450 93A3-like [Nicoti... 72 2e-10 ref|XP_009619292.1| PREDICTED: cytochrome P450 93A3-like [Nicoti... 72 2e-10 gb|KOM38823.1| hypothetical protein LR48_Vigan03g220500 [Vigna a... 71 3e-10 ref|NP_001240973.1| cytochrome P450 93A2 [Glycine max] gi|591585... 71 3e-10 ref|XP_008241038.1| PREDICTED: cytochrome P450 93A3-like [Prunus... 71 3e-10 ref|XP_007203496.1| hypothetical protein PRUPE_ppa024661mg [Prun... 71 3e-10 ref|XP_014494975.1| PREDICTED: cytochrome P450 93A3-like [Vigna ... 71 4e-10 >ref|XP_013442456.1| cytochrome P450 family protein [Medicago truncatula] gi|657370331|gb|KEH16481.1| cytochrome P450 family protein [Medicago truncatula] Length = 513 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPSG 171 A MIQCFEWKV G NG VNM+EK A SLPRAHPL CVP+PRFNCFP G Sbjct: 466 AAMIQCFEWKVGG--NGKVNMDEKAATSLPRAHPLICVPIPRFNCFPFG 512 >ref|XP_003625207.1| cytochrome P450 family protein [Medicago truncatula] gi|355500222|gb|AES81425.1| cytochrome P450 family protein [Medicago truncatula] Length = 511 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEWKV G GNG VNMEEKP ++L RAHPL CVPVPRFN FPS Sbjct: 464 AAMIQCFEWKVKG-GNGIVNMEEKPGLTLSRAHPLICVPVPRFNHFPS 510 >ref|XP_013445816.1| cytochrome P450 family protein [Medicago truncatula] gi|657374239|gb|KEH19842.1| cytochrome P450 family protein [Medicago truncatula] Length = 512 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEW VDG NG V+MEEKPA++LPRAHPL CVPVPRFN PS Sbjct: 465 AAMIQCFEWNVDG--NGKVDMEEKPAVTLPRAHPLICVPVPRFNSIPS 510 >ref|XP_013442455.1| cytochrome P450 family protein [Medicago truncatula] gi|657370330|gb|KEH16480.1| cytochrome P450 family protein [Medicago truncatula] Length = 515 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPSG 171 A MIQCFEWKV G+G TVNMEEKP+ +LPRAHPL CVP+PRF+ FP G Sbjct: 468 AAMIQCFEWKVGGDG--TVNMEEKPSTTLPRAHPLICVPIPRFHSFPFG 514 >ref|XP_013445779.1| cytochrome P450 family protein [Medicago truncatula] gi|657374202|gb|KEH19805.1| cytochrome P450 family protein [Medicago truncatula] Length = 443 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEW VDG NG VNMEEK A++LPRAHPL CVPVPRFN PS Sbjct: 396 AAMIQCFEWNVDG--NGKVNMEEKSAVTLPRAHPLICVPVPRFNTIPS 441 >ref|XP_004497961.2| PREDICTED: cytochrome P450 93A3-like [Cicer arietinum] Length = 499 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A+MIQCF+WKVDG NGTVNM+EKPA++LPRAHPL C PVPRF P Sbjct: 454 AVMIQCFDWKVDG--NGTVNMDEKPAMTLPRAHPLMCFPVPRFKSIP 498 >ref|XP_013442420.1| cytochrome P450 family protein [Medicago truncatula] gi|657370285|gb|KEH16445.1| cytochrome P450 family protein [Medicago truncatula] Length = 506 Score = 77.4 bits (189), Expect = 4e-12 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCF WKV G+G TVNMEEKPA++LPRAHPL CVP+PRF PS Sbjct: 460 AAMIQCFYWKVSGDG--TVNMEEKPALTLPRAHPLMCVPIPRFKSIPS 505 >ref|XP_007162289.1| hypothetical protein PHAVU_001G1395000g, partial [Phaseolus vulgaris] gi|561035753|gb|ESW34283.1| hypothetical protein PHAVU_001G1395000g, partial [Phaseolus vulgaris] Length = 102 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A MIQCFEWKV G GN TV+MEEKP I+L RAHPL CVPVPR N FP Sbjct: 55 AAMIQCFEWKVKG-GNETVDMEEKPGITLSRAHPLVCVPVPRLNPFP 100 >ref|XP_007162282.1| hypothetical protein PHAVU_001G138900g [Phaseolus vulgaris] gi|561035746|gb|ESW34276.1| hypothetical protein PHAVU_001G138900g [Phaseolus vulgaris] Length = 435 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A MIQCFEWKV G GN TV+MEEKP I+L RAHPL CVPVPR N FP Sbjct: 388 AAMIQCFEWKVKG-GNETVDMEEKPGITLSRAHPLVCVPVPRLNPFP 433 >ref|XP_002277107.2| PREDICTED: cytochrome P450 93A3 [Vitis vinifera] Length = 526 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A MIQCFEWKV GNGT+NMEE P ++LPRAHPL CVPV R + FP Sbjct: 480 AAMIQCFEWKVRDGGNGTLNMEEGPGLTLPRAHPLICVPVARLHLFP 526 >gb|KHN07406.1| Cytochrome P450 93A3 [Glycine soja] Length = 510 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A++IQCF+WKVD + NG VNMEEK I+LPRAHP+ CVP+PR N FP Sbjct: 463 AVLIQCFQWKVDSD-NGKVNMEEKAGITLPRAHPIICVPIPRLNPFP 508 >ref|XP_012087731.1| PREDICTED: cytochrome P450 93A3-like [Jatropha curcas] gi|643710447|gb|KDP24589.1| hypothetical protein JCGZ_25505 [Jatropha curcas] Length = 514 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEWKVDG GNGTV+MEE P ++LPRA+PL C P+ R N FPS Sbjct: 467 AAMIQCFEWKVDG-GNGTVDMEEGPGLTLPRANPLICFPMTRLNLFPS 513 >ref|XP_007028932.1| Cytochrome P450 93A3 [Theobroma cacao] gi|508717537|gb|EOY09434.1| Cytochrome P450 93A3 [Theobroma cacao] Length = 512 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCF+WKV+G +GTV+M+E P ++LPRAHPL C+PVPR N FPS Sbjct: 465 AAMIQCFDWKVNG-ADGTVDMKEGPGLTLPRAHPLICIPVPRLNPFPS 511 >ref|XP_009797406.1| PREDICTED: cytochrome P450 93A3-like [Nicotiana sylvestris] Length = 515 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A+MIQCFEWKV G NG V+MEE +LPRAHPL C+PV R N FPS Sbjct: 467 AVMIQCFEWKVSGGVNGKVDMEEGTGFTLPRAHPLNCIPVVRLNPFPS 514 >ref|XP_009619292.1| PREDICTED: cytochrome P450 93A3-like [Nicotiana tomentosiformis] Length = 515 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A+MIQCFEWKV G NG V+MEE +LPRAHPL C+PV R N FPS Sbjct: 467 AVMIQCFEWKVTGGVNGKVDMEEGTGFTLPRAHPLNCIPVARLNPFPS 514 >gb|KOM38823.1| hypothetical protein LR48_Vigan03g220500 [Vigna angularis] Length = 518 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A MIQCFEWKV GE N TV+MEEKP ++L RA PL CVPVPR N FP Sbjct: 471 AAMIQCFEWKVKGE-NETVDMEEKPGLTLSRARPLLCVPVPRLNPFP 516 >ref|NP_001240973.1| cytochrome P450 93A2 [Glycine max] gi|5915852|sp|Q42799.1|C93A2_SOYBN RecName: Full=Cytochrome P450 93A2 gi|1408322|dbj|BAA13076.1| cytochrome P-450 (CYP93A2) [Glycine max] gi|734389676|gb|KHN26361.1| Cytochrome P450 93A2 [Glycine soja] gi|947045714|gb|KRG95343.1| hypothetical protein GLYMA_19G144700 [Glycine max] Length = 502 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A+MIQCF+WK D GN V+MEEK I+LPRAHP+ CVPVPR N FP Sbjct: 455 AIMIQCFQWKFDN-GNNKVDMEEKSGITLPRAHPIICVPVPRLNPFP 500 >ref|XP_008241038.1| PREDICTED: cytochrome P450 93A3-like [Prunus mume] Length = 515 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEWKV+G G+ VNMEE ++LPRAHPL CVPV R N FPS Sbjct: 468 AAMIQCFEWKVEG-GSNNVNMEEAAGLTLPRAHPLVCVPVARLNPFPS 514 >ref|XP_007203496.1| hypothetical protein PRUPE_ppa024661mg [Prunus persica] gi|462399027|gb|EMJ04695.1| hypothetical protein PRUPE_ppa024661mg [Prunus persica] Length = 516 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFPS 174 A MIQCFEWKV+G G+ VNMEE ++LPRAHPL CVPV R N FPS Sbjct: 469 AAMIQCFEWKVEG-GSNNVNMEEAAGLTLPRAHPLVCVPVARLNPFPS 515 >ref|XP_014494975.1| PREDICTED: cytochrome P450 93A3-like [Vigna radiata var. radiata] Length = 563 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 317 AMMIQCFEWKVDGEGNGTVNMEEKPAISLPRAHPLTCVPVPRFNCFP 177 A MIQCF WKV GE N +V+MEEKP ++L RAHPL CVPVPR N FP Sbjct: 511 AAMIQCFRWKVKGE-NESVDMEEKPGLTLSRAHPLLCVPVPRLNPFP 556