BLASTX nr result
ID: Wisteria21_contig00033221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033221 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490432.1| PREDICTED: uncharacterized protein LOC101499... 105 1e-20 ref|XP_003615269.2| transmembrane protein, putative [Medicago tr... 104 3e-20 >ref|XP_004490432.1| PREDICTED: uncharacterized protein LOC101499123 [Cicer arietinum] Length = 423 Score = 105 bits (262), Expect = 1e-20 Identities = 67/115 (58%), Positives = 77/115 (66%), Gaps = 4/115 (3%) Frame = -3 Query: 334 YHYNKKNKHLLLPVSPLAFNPKANNNYLIIRFPNSQNWKIFYPLLIFLVLLVMASFPLIT 155 Y YNK N VS +FNPKA YLI+RFPNS WKIFY L+ L+ L +ASFPLI+ Sbjct: 15 YFYNKNNH-----VSAFSFNPKAY--YLILRFPNSGTWKIFYRLV--LLALFVASFPLIS 65 Query: 154 SSLVSRTTSINLEPQ----LQQAKPEHGSDNSPNMDQLLTLLFNDLTNEGLMKKT 2 SS VSR S++ LQQ +G D S NMDQLLTLLFNDLTNEGL+KKT Sbjct: 66 SSFVSRNPSLDDSTSNMNILQQQ--HNGFDYSINMDQLLTLLFNDLTNEGLVKKT 118 >ref|XP_003615269.2| transmembrane protein, putative [Medicago truncatula] gi|657385188|gb|AES98227.2| transmembrane protein, putative [Medicago truncatula] Length = 419 Score = 104 bits (259), Expect = 3e-20 Identities = 62/110 (56%), Positives = 75/110 (68%) Frame = -3 Query: 331 HYNKKNKHLLLPVSPLAFNPKANNNYLIIRFPNSQNWKIFYPLLIFLVLLVMASFPLITS 152 + + KNKH VS LAFNPKA YLIIRFP S WKIFY L+ L+ L +ASFPLI+S Sbjct: 15 YISNKNKH----VSALAFNPKAY--YLIIRFPYSGTWKIFYRLV--LLALFVASFPLISS 66 Query: 151 SLVSRTTSINLEPQLQQAKPEHGSDNSPNMDQLLTLLFNDLTNEGLMKKT 2 S VSR S++ + P+ + NMDQLLTLLFNDLTNEGL+KK+ Sbjct: 67 SFVSRNPSLDDSASNMKILPQQQLNGFVNMDQLLTLLFNDLTNEGLVKKS 116