BLASTX nr result
ID: Wisteria21_contig00033069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033069 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN35372.1| Putative WRKY transcription factor 30 [Glycine soja] 62 2e-07 ref|XP_003521804.1| PREDICTED: probable WRKY transcription facto... 62 2e-07 ref|XP_003626559.1| WRKY family transcription factor [Medicago t... 62 2e-07 gb|ABS18439.1| WRKY43 [Glycine max] 62 2e-07 ref|XP_014491586.1| PREDICTED: probable WRKY transcription facto... 61 4e-07 ref|XP_007147293.1| hypothetical protein PHAVU_006G111700g [Phas... 60 5e-07 gb|KOM52959.1| hypothetical protein LR48_Vigan09g161800 [Vigna a... 59 1e-06 ref|XP_003554762.1| PREDICTED: probable WRKY transcription facto... 59 1e-06 >gb|KHN35372.1| Putative WRKY transcription factor 30 [Glycine soja] Length = 362 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDILL+KGDFDTDFPFN PE+F Sbjct: 331 VTNSPILDLDILLDKGDFDTDFPFNIPEFF 360 >ref|XP_003521804.1| PREDICTED: probable WRKY transcription factor 53 [Glycine max] gi|947120652|gb|KRH68901.1| hypothetical protein GLYMA_03G256700 [Glycine max] gi|947120653|gb|KRH68902.1| hypothetical protein GLYMA_03G256700 [Glycine max] Length = 362 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDILL+KGDFDTDFPFN PE+F Sbjct: 331 VTNSPILDLDILLDKGDFDTDFPFNIPEFF 360 >ref|XP_003626559.1| WRKY family transcription factor [Medicago truncatula] gi|355501574|gb|AES82777.1| WRKY family transcription factor [Medicago truncatula] Length = 328 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDILL +GDFDTDFP NTPEYF Sbjct: 297 VTNSPILDLDILLQRGDFDTDFPLNTPEYF 326 >gb|ABS18439.1| WRKY43 [Glycine max] Length = 262 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDILL+KGDFDTDFPFN PE+F Sbjct: 231 VTNSPILDLDILLDKGDFDTDFPFNIPEFF 260 >ref|XP_014491586.1| PREDICTED: probable WRKY transcription factor 30 [Vigna radiata var. radiata] Length = 371 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDILL+KGDFDTDFPFN P++F Sbjct: 332 VTNSPILDLDILLHKGDFDTDFPFNNPDFF 361 >ref|XP_007147293.1| hypothetical protein PHAVU_006G111700g [Phaseolus vulgaris] gi|561020516|gb|ESW19287.1| hypothetical protein PHAVU_006G111700g [Phaseolus vulgaris] Length = 373 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDI L+KGDFDTDFPFNTP++F Sbjct: 334 VTNSPILDLDIWLHKGDFDTDFPFNTPDFF 363 >gb|KOM52959.1| hypothetical protein LR48_Vigan09g161800 [Vigna angularis] Length = 371 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VTNSPILDLDI L+KGDFDTDFPFN P++F Sbjct: 332 VTNSPILDLDIFLHKGDFDTDFPFNNPDFF 361 >ref|XP_003554762.1| PREDICTED: probable WRKY transcription factor 53-like [Glycine max] gi|947047525|gb|KRG97154.1| hypothetical protein GLYMA_19G254800 [Glycine max] Length = 362 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 241 VTNSPILDLDILLNKGDFDTDFPFNTPEYF 152 VT SPILDLDILL+KGDFDTDFPFN PE+F Sbjct: 331 VTKSPILDLDILLDKGDFDTDFPFNIPEFF 360