BLASTX nr result
ID: Wisteria21_contig00033046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00033046 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH57984.1| hypothetical protein GLYMA_05G098300 [Glycine max] 58 3e-06 >gb|KRH57984.1| hypothetical protein GLYMA_05G098300 [Glycine max] Length = 72 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 PQTSTSFFIVLCSHSHTL*ETSQKVTYPTIAPSQACLTL 117 PQT+ F VLC HS L ETSQ+VTYP IAPSQACLT+ Sbjct: 3 PQTNMRLFSVLCPHSQNLQETSQRVTYPIIAPSQACLTV 41