BLASTX nr result
ID: Wisteria21_contig00029016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00029016 (274 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9... 74 6e-11 ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9... 60 8e-07 ref|XP_014503220.1| PREDICTED: ABC transporter G family member 9... 57 4e-06 gb|KOM43669.1| hypothetical protein LR48_Vigan05g127400 [Vigna a... 56 9e-06 >ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9 [Cicer arietinum] Length = 630 Score = 73.6 bits (179), Expect = 6e-11 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 2/59 (3%) Frame = -2 Query: 171 MERDMEDIEGQ--YKETTVNEEAPDNILHKGKCSVILKFDDVVYKIKTKKGGLFEKNAK 1 ME+DMEDIE Q YKET + EE P +ILH K VILKFDDVVYKIK KGGLF+KN K Sbjct: 1 MEQDMEDIECQTIYKET-LEEEPPADILHNRKRPVILKFDDVVYKIKANKGGLFKKNKK 58 >ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max] gi|947073245|gb|KRH22136.1| hypothetical protein GLYMA_13G279800 [Glycine max] Length = 627 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = -2 Query: 165 RDMEDIEGQYKETTVNEEAPDNILHKGKCSVILKFDDVVYKIKTKKGGLFEKN 7 ++M DIE Q E PD ILHKGK VILKFD+VVYKIKTKKGG+F KN Sbjct: 7 QEMVDIESQ------TVEIPD-ILHKGKRQVILKFDNVVYKIKTKKGGVFVKN 52 >ref|XP_014503220.1| PREDICTED: ABC transporter G family member 9 [Vigna radiata var. radiata] Length = 624 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 165 RDMEDIEGQYKETTVNEEAPDNILHKGKCSVILKFDDVVYKIKTKKGGLFEKN 7 +++ DIE Q N + P ++ HK K V LKFDDVVYKIKT+KGGLF+KN Sbjct: 4 QEIADIESQ------NVDTPPHVSHKVKRQVTLKFDDVVYKIKTRKGGLFKKN 50 >gb|KOM43669.1| hypothetical protein LR48_Vigan05g127400 [Vigna angularis] Length = 624 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 165 RDMEDIEGQYKETTVNEEAPDNILHKGKCSVILKFDDVVYKIKTKKGGLFEKNAK 1 +++ DIE Q N +AP ++ HK K V LKFDDVVYKIKT+KGGLF K + Sbjct: 4 QEIADIESQ------NMDAPPDVSHKVKRQVTLKFDDVVYKIKTRKGGLFTKKGE 52