BLASTX nr result
ID: Wisteria21_contig00028880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00028880 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012575339.1| PREDICTED: endo-1,3(4)-beta-glucanase 2-like... 61 4e-07 ref|XP_012575338.1| PREDICTED: endo-1,3(4)-beta-glucanase 1-like... 57 4e-06 ref|XP_013451220.1| glycoside hydrolase family 81 protein [Medic... 57 5e-06 >ref|XP_012575339.1| PREDICTED: endo-1,3(4)-beta-glucanase 2-like isoform X1 [Cicer arietinum] gi|828335082|ref|XP_012575340.1| PREDICTED: endo-1,3(4)-beta-glucanase 2-like isoform X2 [Cicer arietinum] gi|828335084|ref|XP_012575341.1| PREDICTED: endo-1,3(4)-beta-glucanase 2-like isoform X3 [Cicer arietinum] Length = 676 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 94 MPNNTKNTPFIFPQTHSTVLPDPSNFFSPNL 2 MPNN KN PF+FPQ STVLPDPSNFFSPNL Sbjct: 1 MPNNNKNKPFLFPQIQSTVLPDPSNFFSPNL 31 >ref|XP_012575338.1| PREDICTED: endo-1,3(4)-beta-glucanase 1-like [Cicer arietinum] Length = 673 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 79 KNTPFIFPQTHSTVLPDPSNFFSPNL 2 KNTPFIFPQT+STVLPDPSNFFSPNL Sbjct: 6 KNTPFIFPQTNSTVLPDPSNFFSPNL 31 >ref|XP_013451220.1| glycoside hydrolase family 81 protein [Medicago truncatula] gi|657381255|gb|KEH25260.1| glycoside hydrolase family 81 protein [Medicago truncatula] Length = 749 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 91 PNNTKNTPFIFPQTHSTVLPDPSNFFSPNL 2 P NTPF+FPQ HST+LPDPSNFFSPNL Sbjct: 66 PKQPTNTPFLFPQVHSTILPDPSNFFSPNL 95