BLASTX nr result
ID: Wisteria21_contig00028863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00028863 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM50960.1| hypothetical protein LR48_Vigan08g178700 [Vigna a... 59 1e-06 ref|XP_007131731.1| hypothetical protein PHAVU_011G037100g [Phas... 57 4e-06 >gb|KOM50960.1| hypothetical protein LR48_Vigan08g178700 [Vigna angularis] Length = 90 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 253 MGFRLPGIRRASTTQTASKGAEVPKGYLAVYVGD 354 MGFRLPGIRRAS Q +SK EVPKGYLAVYVG+ Sbjct: 1 MGFRLPGIRRASANQASSKAVEVPKGYLAVYVGE 34 >ref|XP_007131731.1| hypothetical protein PHAVU_011G037100g [Phaseolus vulgaris] gi|561004731|gb|ESW03725.1| hypothetical protein PHAVU_011G037100g [Phaseolus vulgaris] Length = 136 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +1 Query: 217 HSLVPGVNQHSTMGFRLPGIRRAS--TTQTASKGAEVPKGYLAVYVGD 354 H+ V+ H TMGFRLPG+R+ S T Q +SKG +V KGYLAVYVG+ Sbjct: 29 HNFFSEVSTHITMGFRLPGMRKTSFATNQASSKGMDVAKGYLAVYVGE 76