BLASTX nr result
ID: Wisteria21_contig00027997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027997 (262 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485463.1| PREDICTED: ATP phosphoribosyltransferase 2, ... 61 3e-07 >ref|XP_004485463.1| PREDICTED: ATP phosphoribosyltransferase 2, chloroplastic-like [Cicer arietinum] Length = 378 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -3 Query: 137 TMSQIRFPLHAKSGSWCCYASLSETQVLNGNPGSTVSDRQEIRLG 3 TMSQIRFPL+ S ASLSET+VLNGNPG T+S RQEIRLG Sbjct: 4 TMSQIRFPLYCCYASSSSSASLSETKVLNGNPGGTLSARQEIRLG 48