BLASTX nr result
ID: Wisteria21_contig00027983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027983 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492460.1| PREDICTED: protein SCO1 homolog 1, mitochond... 63 1e-07 >ref|XP_004492460.1| PREDICTED: protein SCO1 homolog 1, mitochondrial [Cicer arietinum] Length = 320 Score = 62.8 bits (151), Expect = 1e-07 Identities = 38/76 (50%), Positives = 43/76 (56%) Frame = -3 Query: 238 MASIICRKTNHFRYATRFLCTHLLRHRTPTXXXXXXXXXXXXXXXXXXXXXXPVGNHGYG 59 MAS+I KTNHFRYA+RFL +HLLRH TPT VGN GYG Sbjct: 1 MASLISTKTNHFRYASRFLFSHLLRHSTPT----SSLLSPSFAHHLSSHHPHQVGNQGYG 56 Query: 58 NGSLVLLCQRFLSDTA 11 GSL +L QR LS T+ Sbjct: 57 IGSL-MLYQRLLSSTS 71