BLASTX nr result
ID: Wisteria21_contig00027714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027714 (227 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phas... 65 2e-08 ref|XP_014490397.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|KOM44039.1| hypothetical protein LR48_Vigan05g164400 [Vigna a... 63 1e-07 ref|XP_003596872.1| PPR containing plant-like protein [Medicago ... 62 1e-07 ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 gb|KRH26675.1| hypothetical protein GLYMA_12G188000 [Glycine max] 60 7e-07 gb|KHN17971.1| Pentatricopeptide repeat-containing protein, chlo... 60 7e-07 ref|XP_010092553.1| hypothetical protein L484_001219 [Morus nota... 59 1e-06 ref|XP_008458940.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|ABD32771.1| Tetratricopeptide-like helical [Medicago truncatula] 59 1e-06 ref|XP_004487456.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_007015694.1| Tetratricopeptide repeat (TPR)-like superfam... 58 2e-06 ref|XP_006481538.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_006424118.1| hypothetical protein CICLE_v10028449mg [Citr... 58 3e-06 >ref|XP_003541961.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Glycine max] gi|734413051|gb|KHN36496.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gi|947073747|gb|KRH22638.1| hypothetical protein GLYMA_13G313200 [Glycine max] Length = 521 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 I+LARQ+F+ MP RTLVS NSIIVGFA+NGL D+ALS+F SMQ Sbjct: 278 IDLARQVFDRMPQRTLVSWNSIIVGFAVNGLADEALSYFNSMQ 320 >ref|XP_007150033.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] gi|561023297|gb|ESW22027.1| hypothetical protein PHAVU_005G120400g [Phaseolus vulgaris] Length = 514 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ MP+RTLVS NSIIVGFA+NG D+AL++F SMQ Sbjct: 271 IELARQVFDRMPNRTLVSWNSIIVGFAVNGFADEALNYFNSMQ 313 >ref|XP_014490397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 514 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ MP+RTLV+ NSIIVGFA+NG D+AL++F SMQ Sbjct: 271 IELARQVFDRMPNRTLVTWNSIIVGFAVNGFADEALNYFNSMQ 313 >gb|KOM44039.1| hypothetical protein LR48_Vigan05g164400 [Vigna angularis] Length = 514 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ MP+RTLV+ NSIIVGFA+NG D+AL+ F SMQ Sbjct: 271 IELARQVFDRMPNRTLVTWNSIIVGFAVNGFADEALNHFNSMQ 313 >ref|XP_003596872.1| PPR containing plant-like protein [Medicago truncatula] gi|87240903|gb|ABD32761.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355485920|gb|AES67123.1| PPR containing plant-like protein [Medicago truncatula] Length = 517 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ M R LVS NSIIVGFA+NGL D+ALSFF SM+ Sbjct: 274 IELARQVFDGMSQRNLVSWNSIIVGFAVNGLADKALSFFRSMK 316 >ref|XP_004139593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Cucumis sativus] gi|700209875|gb|KGN64971.1| hypothetical protein Csa_1G169950 [Cucumis sativus] Length = 525 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IE ARQ+F M RTLVS NSIIVGFA+NG D++L FFY+MQ Sbjct: 278 IEFARQVFVKMAKRTLVSWNSIIVGFAVNGFADESLEFFYAMQ 320 >gb|KRH26675.1| hypothetical protein GLYMA_12G188000 [Glycine max] Length = 484 Score = 60.1 bits (144), Expect = 7e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ MP RTLVS NSIIV FA NGL D+AL+ F SMQ Sbjct: 260 IELARQVFDRMPQRTLVSWNSIIVDFAANGLADEALNNFNSMQ 302 >gb|KHN17971.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 450 Score = 60.1 bits (144), Expect = 7e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELARQ+F+ MP RTLVS NSIIV FA NGL D+AL+ F SMQ Sbjct: 231 IELARQVFDRMPQRTLVSWNSIIVDFAANGLADEALNNFNSMQ 273 >ref|XP_010092553.1| hypothetical protein L484_001219 [Morus notabilis] gi|587951969|gb|EXC37761.1| hypothetical protein L484_001219 [Morus notabilis] Length = 508 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IE ARQ+F MP+RTLVS NSIIVGFA+NG ++AL FF MQ Sbjct: 268 IEFARQVFERMPNRTLVSWNSIIVGFAVNGHAEEALKFFNLMQ 310 >ref|XP_008458940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Cucumis melo] Length = 522 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IE ARQ+F M RTLVS NSIIVGFA NG D++L FFY+MQ Sbjct: 275 IEFARQVFVKMAKRTLVSWNSIIVGFAFNGFADESLEFFYAMQ 317 >gb|ABD32771.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 497 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFF 110 IELARQ+F+ M R LVS NSIIVGFA+NGL D+ALSFF Sbjct: 274 IELARQVFDGMSQRNLVSWNSIIVGFAVNGLADKALSFF 312 >ref|XP_004487456.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Cicer arietinum] Length = 512 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 I ARQ+F+ M R LVS NSII+GFA+NG D+ALSFFYSM+ Sbjct: 269 IGFARQVFDGMSQRNLVSWNSIIIGFAVNGHADEALSFFYSMK 311 >ref|XP_004293118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic [Fragaria vesca subsp. vesca] Length = 504 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 I+ ARQ+F MP+RTLVS NS+IVGFA+NG ++AL FF+ MQ Sbjct: 266 IDFARQVFGNMPNRTLVSWNSMIVGFAVNGHAEEALEFFHQMQ 308 >ref|XP_007015694.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786057|gb|EOY33313.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 509 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IELAR++F+ M RTLVS NSIIVGFA+NG ++AL +F SMQ Sbjct: 266 IELAREVFDKMQKRTLVSWNSIIVGFAVNGFAEEALKYFDSMQ 308 >ref|XP_006481538.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Citrus sinensis] gi|641839316|gb|KDO58247.1| hypothetical protein CISIN_1g010496mg [Citrus sinensis] Length = 509 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IE ARQ+F M RTLVS NSIIVGFA+NG V +AL +F SMQ Sbjct: 266 IEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNSMQ 308 >ref|XP_006424118.1| hypothetical protein CICLE_v10028449mg [Citrus clementina] gi|557526052|gb|ESR37358.1| hypothetical protein CICLE_v10028449mg [Citrus clementina] Length = 445 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 226 IELARQMFNAMPHRTLVSCNSIIVGFAINGLVDQALSFFYSMQ 98 IE ARQ+F M RTLVS NSIIVGFA+NG V +AL +F SMQ Sbjct: 196 IEFARQVFQRMHKRTLVSWNSIIVGFAVNGFVGEALEYFNSMQ 238