BLASTX nr result
ID: Wisteria21_contig00027521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00027521 (284 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09793.1| hypothetical protein B456_001G166700 [Gossypium r... 102 1e-19 >gb|KJB09793.1| hypothetical protein B456_001G166700 [Gossypium raimondii] Length = 636 Score = 102 bits (253), Expect = 1e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 177 KRTCVKQPSITLDRSRMDDLQLKVSSSDRYIVRRNGDLGLGPVVRRIRDLTMF 19 KRTCVKQPSITLDRSRMD+LQLKVSSSDRY+VRRNGDLGL PVVRRIRDLTMF Sbjct: 60 KRTCVKQPSITLDRSRMDNLQLKVSSSDRYLVRRNGDLGLDPVVRRIRDLTMF 112