BLASTX nr result
ID: Wisteria21_contig00026904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00026904 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013446325.1| transducin/WD40 repeat protein [Medicago tru... 58 2e-06 ref|XP_014509338.1| PREDICTED: uncharacterized protein LOC106768... 57 4e-06 gb|KRH07879.1| hypothetical protein GLYMA_16G116200 [Glycine max] 57 4e-06 gb|KOM32137.1| hypothetical protein LR48_Vigan01g169300 [Vigna a... 57 4e-06 ref|XP_006599278.1| PREDICTED: uncharacterized protein LOC100811... 57 4e-06 ref|XP_006599277.1| PREDICTED: uncharacterized protein LOC100811... 57 4e-06 ref|XP_003548801.1| PREDICTED: uncharacterized protein LOC100811... 57 4e-06 >ref|XP_013446325.1| transducin/WD40 repeat protein [Medicago truncatula] gi|657374864|gb|KEH20352.1| transducin/WD40 repeat protein [Medicago truncatula] Length = 1054 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKKPGG+S +GLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKPGGNSIEGLKASDVDPR 31 >ref|XP_014509338.1| PREDICTED: uncharacterized protein LOC106768614 [Vigna radiata var. radiata] Length = 1054 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31 >gb|KRH07879.1| hypothetical protein GLYMA_16G116200 [Glycine max] Length = 1021 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31 >gb|KOM32137.1| hypothetical protein LR48_Vigan01g169300 [Vigna angularis] Length = 1053 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31 >ref|XP_006599278.1| PREDICTED: uncharacterized protein LOC100811900 isoform X3 [Glycine max] gi|947058472|gb|KRH07878.1| hypothetical protein GLYMA_16G116200 [Glycine max] Length = 1036 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31 >ref|XP_006599277.1| PREDICTED: uncharacterized protein LOC100811900 isoform X2 [Glycine max] Length = 1051 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31 >ref|XP_003548801.1| PREDICTED: uncharacterized protein LOC100811900 isoform X1 [Glycine max] gi|947058471|gb|KRH07877.1| hypothetical protein GLYMA_16G116200 [Glycine max] Length = 1055 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MFVKKLVEKASIKKPGGSSPDGLKASDVDPR 342 MFVKKLVEKASIKK GG+S DGLKASDVDPR Sbjct: 1 MFVKKLVEKASIKKTGGNSSDGLKASDVDPR 31