BLASTX nr result
ID: Wisteria21_contig00026713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00026713 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containi... 155 1e-35 gb|KRH20739.1| hypothetical protein GLYMA_13G197700 [Glycine max] 151 2e-34 ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containi... 151 2e-34 ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containi... 151 2e-34 ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containi... 145 1e-32 ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phas... 135 2e-29 gb|KOM49220.1| hypothetical protein LR48_Vigan08g004700 [Vigna a... 134 3e-29 ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containi... 130 4e-28 ref|XP_014522800.1| PREDICTED: pentatricopeptide repeat-containi... 129 9e-28 ref|XP_003627859.1| PPR containing plant-like protein [Medicago ... 128 1e-27 ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prun... 128 2e-27 ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-25 ref|XP_009340504.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_008465224.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_009338086.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_008338591.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 ref|XP_012480154.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfam... 109 9e-22 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 106 8e-21 >ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] gi|947064131|gb|KRH13392.1| hypothetical protein GLYMA_15G236300 [Glycine max] gi|947064132|gb|KRH13393.1| hypothetical protein GLYMA_15G236300 [Glycine max] Length = 587 Score = 155 bits (392), Expect = 1e-35 Identities = 74/91 (81%), Positives = 81/91 (89%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHWGNLLKVK NAS LTS+TIH+VLLQLSLYGYG S F FFKW SIPHY+HSLQCS Sbjct: 19 VKGHWGNLLKVK-NASALTSSTIHKVLLQLSLYGYGLSHSFPFFKWLDSIPHYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFKTAQH+L+KIAHKD LSS Sbjct: 78 WAMIHILTEHKHFKTAQHVLEKIAHKDFLSS 108 >gb|KRH20739.1| hypothetical protein GLYMA_13G197700 [Glycine max] Length = 547 Score = 151 bits (382), Expect = 2e-34 Identities = 72/91 (79%), Positives = 79/91 (86%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHWG+L KVK N S LTS+TIH+VLLQLSLYGYG S F FFKW SIPHY+HSLQCS Sbjct: 19 VKGHWGDLSKVK-NVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSIPHYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFKTAQHML+KIAHKD LSS Sbjct: 78 WAMIHILTEHKHFKTAQHMLEKIAHKDFLSS 108 >ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X7 [Glycine max] gi|947071847|gb|KRH20738.1| hypothetical protein GLYMA_13G197700 [Glycine max] Length = 542 Score = 151 bits (382), Expect = 2e-34 Identities = 72/91 (79%), Positives = 79/91 (86%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHWG+L KVK N S LTS+TIH+VLLQLSLYGYG S F FFKW SIPHY+HSLQCS Sbjct: 19 VKGHWGDLSKVK-NVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSIPHYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFKTAQHML+KIAHKD LSS Sbjct: 78 WAMIHILTEHKHFKTAQHMLEKIAHKDFLSS 108 >ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] gi|571499072|ref|XP_006594396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X2 [Glycine max] gi|571499074|ref|XP_006594397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X3 [Glycine max] gi|571499076|ref|XP_006594398.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X4 [Glycine max] gi|571499078|ref|XP_006594399.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X5 [Glycine max] gi|571499080|ref|XP_006594400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X6 [Glycine max] gi|947071850|gb|KRH20741.1| hypothetical protein GLYMA_13G197700 [Glycine max] gi|947071851|gb|KRH20742.1| hypothetical protein GLYMA_13G197700 [Glycine max] Length = 587 Score = 151 bits (382), Expect = 2e-34 Identities = 72/91 (79%), Positives = 79/91 (86%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHWG+L KVK N S LTS+TIH+VLLQLSLYGYG S F FFKW SIPHY+HSLQCS Sbjct: 19 VKGHWGDLSKVK-NVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSIPHYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFKTAQHML+KIAHKD LSS Sbjct: 78 WAMIHILTEHKHFKTAQHMLEKIAHKDFLSS 108 >ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] gi|828329427|ref|XP_012574242.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] gi|828329429|ref|XP_012574243.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cicer arietinum] Length = 588 Score = 145 bits (366), Expect = 1e-32 Identities = 68/91 (74%), Positives = 78/91 (85%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG+W NLLK+K AS LTSTTIH+V+L L +GYGP IF FFKW HSIPHYTHSLQCS Sbjct: 20 VKGNWNNLLKLKI-ASTLTSTTIHQVILHLRQHGYGPFFIFQFFKWVHSIPHYTHSLQCS 78 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 WSMIH+LTKH+HFKTAQ +LDK+A K+MLSS Sbjct: 79 WSMIHMLTKHSHFKTAQQVLDKMAQKEMLSS 109 >ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263178|ref|XP_007133768.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263180|ref|XP_007133769.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006767|gb|ESW05761.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006768|gb|ESW05762.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006769|gb|ESW05763.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] Length = 587 Score = 135 bits (339), Expect = 2e-29 Identities = 65/91 (71%), Positives = 76/91 (83%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 +KG+WGNLLKVK NAS TS+TIH+VLLQLSLY G F FFKW SIPHY+HSLQCS Sbjct: 19 IKGNWGNLLKVK-NASAFTSSTIHQVLLQLSLYDSGIFHSFPFFKWLDSIPHYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFKTAQ+ML+KIA++D L S Sbjct: 78 WAMIHILTEHKHFKTAQNMLEKIANRDFLPS 108 >gb|KOM49220.1| hypothetical protein LR48_Vigan08g004700 [Vigna angularis] Length = 587 Score = 134 bits (337), Expect = 3e-29 Identities = 64/91 (70%), Positives = 75/91 (82%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 +KG+WGNLLKVK + S TS+TIH+VLLQLSLY YG S F FFKW SIP+Y+HSLQCS Sbjct: 19 IKGNWGNLLKVK-STSAFTSSTIHQVLLQLSLYDYGLSHSFPFFKWLDSIPNYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W MIHILT+H HFKTA HML+KIA++D L S Sbjct: 78 WVMIHILTEHKHFKTAHHMLEKIANRDFLPS 108 >ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Fragaria vesca subsp. vesca] Length = 589 Score = 130 bits (327), Expect = 4e-28 Identities = 62/91 (68%), Positives = 72/91 (79%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 +KGHW +LL K S LTS+ IH+VLLQLSLYGY PSL SFFKWA S+P+Y HSLQCS Sbjct: 22 LKGHWSHLLNPKLG-SCLTSSAIHQVLLQLSLYGYTPSLSLSFFKWAESLPNYKHSLQCS 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+M+HILTKH HFKTA L+KIA +D LSS Sbjct: 81 WTMVHILTKHRHFKTAHQFLEKIAFRDFLSS 111 >ref|XP_014522800.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Vigna radiata var. radiata] Length = 587 Score = 129 bits (324), Expect = 9e-28 Identities = 62/91 (68%), Positives = 74/91 (81%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 +KG+WGNLLKVK + S +S+TI +VLLQLSLY YG S F FFKW SIP+Y+HSLQCS Sbjct: 19 IKGNWGNLLKVK-STSAFSSSTIQQVLLQLSLYDYGLSHSFPFFKWLGSIPNYSHSLQCS 77 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W MIHILT+H HFKTA HML+KIA++D L S Sbjct: 78 WVMIHILTEHKHFKTAHHMLEKIANRDFLPS 108 >ref|XP_003627859.1| PPR containing plant-like protein [Medicago truncatula] gi|355521881|gb|AET02335.1| PPR containing plant-like protein [Medicago truncatula] Length = 731 Score = 128 bits (322), Expect = 1e-27 Identities = 62/91 (68%), Positives = 71/91 (78%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG W NLLK K AS LTSTTIH+V+L L + Y P IF FFKWA SIPHYTHSL S Sbjct: 23 VKGDWNNLLK-PKTASTLTSTTIHQVILHLKQHRYEPFFIFHFFKWAQSIPHYTHSLHSS 81 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 WSMIH+LTKH HFKTAQ +LDK+A +++LSS Sbjct: 82 WSMIHMLTKHRHFKTAQQVLDKMAQREILSS 112 >ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] gi|462403897|gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] Length = 589 Score = 128 bits (321), Expect = 2e-27 Identities = 61/91 (67%), Positives = 72/91 (79%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHW N+LK K +S L+S IH+VLLQLSL+GYGPS ++FFKW SIP Y HSLQC Sbjct: 22 VKGHWNNILKPKIGSS-LSSANIHQVLLQLSLHGYGPSPSWAFFKWVQSIPTYKHSLQCC 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFK AQ +L+KIA KD LSS Sbjct: 81 WTMIHILTEHKHFKPAQQLLEKIAFKDFLSS 111 >ref|XP_008233899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Prunus mume] Length = 589 Score = 124 bits (311), Expect = 3e-26 Identities = 60/91 (65%), Positives = 71/91 (78%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG W N+LK K +S L+S IH+VLLQLSL+GYGPS ++FFKW SIP Y HSLQC Sbjct: 22 VKGQWNNILKPKIGSS-LSSANIHQVLLQLSLHGYGPSPSWAFFKWVESIPTYKHSLQCC 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILT+H HFK AQ +L+KIA KD LSS Sbjct: 81 WTMIHILTEHKHFKPAQQLLEKIALKDFLSS 111 >ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cucumis sativus] gi|700195674|gb|KGN50851.1| hypothetical protein Csa_5G289620 [Cucumis sativus] Length = 578 Score = 120 bits (300), Expect = 5e-25 Identities = 58/91 (63%), Positives = 72/91 (79%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHW +LLK K ++S LTS +IH++LL+LS Y GPSL ++FFKW IP Y HSLQ S Sbjct: 13 VKGHWNHLLKPKISSS-LTSKSIHQILLRLSFYCSGPSLSWAFFKWVELIPDYKHSLQSS 71 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MI ILT+H HFKTAQ +L+KIAHKD +SS Sbjct: 72 WAMIFILTEHKHFKTAQGLLEKIAHKDFISS 102 >ref|XP_009340504.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Pyrus x bretschneideri] Length = 585 Score = 119 bits (297), Expect = 1e-24 Identities = 59/91 (64%), Positives = 68/91 (74%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG W NLLK N S L+S TIH+VLLQLS +GYG S ++FFKW S+P HSLQCS Sbjct: 22 VKGQWSNLLK-PNNDSLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVESLPSCKHSLQCS 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILTKH HFK A +L+KIA KD LSS Sbjct: 81 WTMIHILTKHTHFKPAHQLLEKIALKDFLSS 111 >ref|XP_008465224.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Cucumis melo] Length = 578 Score = 118 bits (296), Expect = 2e-24 Identities = 57/91 (62%), Positives = 71/91 (78%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKGHW +LLK K ++S LTS +IH++L +LS Y GPSL ++FFKW IP Y HSLQ S Sbjct: 13 VKGHWNHLLKPKISSS-LTSKSIHQILFRLSFYCSGPSLSWAFFKWVELIPDYKHSLQSS 71 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MI ILT+H HFKTAQ +L+KIAHKD +SS Sbjct: 72 WAMIFILTEHKHFKTAQGLLEKIAHKDFISS 102 >ref|XP_009338086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Pyrus x bretschneideri] Length = 585 Score = 116 bits (291), Expect = 6e-24 Identities = 58/91 (63%), Positives = 67/91 (73%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG W LLK N S L+S TIH+VLLQLS +GYG S ++FFKW S+P HSLQCS Sbjct: 22 VKGQWSKLLK-PNNHSLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVESLPSCKHSLQCS 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILTKH HFK A +L+KIA KD LSS Sbjct: 81 WTMIHILTKHTHFKPAHQLLEKIALKDFLSS 111 >ref|XP_008338591.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Malus domestica] Length = 585 Score = 116 bits (290), Expect = 8e-24 Identities = 58/91 (63%), Positives = 67/91 (73%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHSIPHYTHSLQCS 95 VKG W NLLK N L+S TIH+VLLQLS +GYG S ++FFKW S+P HSLQCS Sbjct: 22 VKGQWSNLLK-PNNDFLLSSATIHQVLLQLSFHGYGLSPSWAFFKWVESLPTCKHSLQCS 80 Query: 94 WSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 W+MIHILTKH HFK A +L+KIA KD LSS Sbjct: 81 WTMIHILTKHTHFKPAHQLLEKIALKDFLSS 111 >ref|XP_012480154.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730 [Gossypium raimondii] gi|763765010|gb|KJB32264.1| hypothetical protein B456_005G232200 [Gossypium raimondii] Length = 589 Score = 110 bits (276), Expect = 3e-22 Identities = 54/92 (58%), Positives = 70/92 (76%), Gaps = 1/92 (1%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWA-HSIPHYTHSLQC 98 +KGHW +LL+ K S +TSTTI+ +LL LS++ SL +SFF+W +SIP Y HSLQ Sbjct: 16 LKGHWNHLLE-PKICSQITSTTINHLLLHLSVFSCNASLSWSFFQWVKNSIPTYNHSLQS 74 Query: 97 SWSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 +W+M+HILTKH HFKTA H+LDKI +KD LSS Sbjct: 75 TWTMVHILTKHKHFKTAHHLLDKIPNKDFLSS 106 >ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508712456|gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 593 Score = 109 bits (272), Expect = 9e-22 Identities = 55/92 (59%), Positives = 70/92 (76%), Gaps = 1/92 (1%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAH-SIPHYTHSLQC 98 +KGHW LLK K + LTSTTI+ +L +LSL+ PSL +SFFKW SIP+Y HSLQ Sbjct: 22 LKGHWNTLLK-PKICTQLTSTTINYLLYKLSLFCSSPSLSWSFFKWIEISIPNYDHSLQS 80 Query: 97 SWSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 +W+M+HILTKH HFKTA ++L KI++KD LSS Sbjct: 81 TWAMVHILTKHKHFKTAHNLLGKISNKDFLSS 112 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 106 bits (264), Expect = 8e-21 Identities = 53/92 (57%), Positives = 69/92 (75%), Gaps = 1/92 (1%) Frame = -2 Query: 274 VKGHWGNLLKVKKNASPLTSTTIHRVLLQLSLYGYGPSLIFSFFKWAHS-IPHYTHSLQC 98 +KG W NLL+ K S LT++T+H+VL QLSL+ GP L ++ FKW S IP+Y HSLQ Sbjct: 22 IKGGWNNLLR-PKICSILTASTLHQVLYQLSLHSQGPCLSWALFKWIESSIPNYKHSLQS 80 Query: 97 SWSMIHILTKHNHFKTAQHMLDKIAHKDMLSS 2 SW+MIHILTK H KTAQ +L+KIA++D LS+ Sbjct: 81 SWTMIHILTKFKHLKTAQSLLEKIAYRDFLST 112