BLASTX nr result
ID: Wisteria21_contig00026516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00026516 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014498076.1| PREDICTED: flocculation protein FLO11 [Vigna... 62 2e-07 gb|KOM28144.1| hypothetical protein LR48_Vigan503s001900 [Vigna ... 62 2e-07 >ref|XP_014498076.1| PREDICTED: flocculation protein FLO11 [Vigna radiata var. radiata] Length = 585 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 147 MRNNSGTFHSLSSTALFPQSI*TSTPNSQSHRTSSAITSVNMDGSI 284 +RN SG SLS+T LFPQSI TSTP SQSHR SSA SV+M+GS+ Sbjct: 451 IRNGSGNIRSLSNTTLFPQSIRTSTPRSQSHRVSSAPASVDMNGSL 496 >gb|KOM28144.1| hypothetical protein LR48_Vigan503s001900 [Vigna angularis] Length = 585 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 147 MRNNSGTFHSLSSTALFPQSI*TSTPNSQSHRTSSAITSVNMDGSI 284 +RN SG SLS+T LFPQSI TSTP SQSHR SSA SV+M+GS+ Sbjct: 451 IRNGSGNIRSLSNTTLFPQSIRTSTPRSQSHRVSSAPASVDMNGSL 496