BLASTX nr result
ID: Wisteria21_contig00026124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00026124 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM33130.1| hypothetical protein LR48_Vigan01g268600 [Vigna a... 54 8e-12 >gb|KOM33130.1| hypothetical protein LR48_Vigan01g268600 [Vigna angularis] Length = 85 Score = 53.9 bits (128), Expect(2) = 8e-12 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 135 FFHSQIQEEIDEPLPPVTSPQLHTIQYIHPSNINKN 242 FFHSQIQEEIDEPLPPVTSP LHT Q ++NKN Sbjct: 25 FFHSQIQEEIDEPLPPVTSPHLHTHQK-QIISLNKN 59 Score = 42.7 bits (99), Expect(2) = 8e-12 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 80 KGKVSAGCRGLSTDSCFVF 136 +GKVSAGCRGLSTDSCFVF Sbjct: 7 RGKVSAGCRGLSTDSCFVF 25