BLASTX nr result
ID: Wisteria21_contig00023974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00023974 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013459951.1| transmembrane protein, putative [Medicago tr... 45 8e-07 >ref|XP_013459951.1| transmembrane protein, putative [Medicago truncatula] gi|657393130|gb|KEH33982.1| transmembrane protein, putative [Medicago truncatula] Length = 110 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 184 VIXLLMEAGDMIRGVPKEVADLKAELESIEDF 89 ++ LL EA +MIR VPKE+A+LK ELESIEDF Sbjct: 61 LLPLLKEAFNMIRVVPKEIAELKEELESIEDF 92 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 248 ISPLSRNQRHNKMCDTVLSLARDXXL 171 I+ + NQR+NKMCDT LS ARD L Sbjct: 29 ITLANSNQRYNKMCDTALSCARDHLL 54