BLASTX nr result
ID: Wisteria21_contig00023958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00023958 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013453898.1| lipase, putative [Medicago truncatula] gi|65... 69 1e-09 >ref|XP_013453898.1| lipase, putative [Medicago truncatula] gi|657384887|gb|KEH27929.1| lipase, putative [Medicago truncatula] Length = 103 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -1 Query: 360 PHPSSSKNLHHLFQSMLRYLQLVALSDNFAVTVLTMHGSCF*LAAV*LAIV 208 PHPSSSK+L+HLFQSM YLQLV+L +N VT L++HG CF L V +AIV Sbjct: 52 PHPSSSKSLNHLFQSMFHYLQLVSLCENSVVTFLSIHGGCFQLVVVNIAIV 102