BLASTX nr result
ID: Wisteria21_contig00023851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00023851 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013452082.1| pentatricopeptide (PPR) repeat protein [Medi... 69 2e-09 ref|XP_013443362.1| pentatricopeptide (PPR) repeat protein [Medi... 67 5e-09 ref|XP_003621397.1| pentatricopeptide (PPR) repeat protein [Medi... 67 7e-09 ref|XP_003599547.2| pentatricopeptide (PPR) repeat protein [Medi... 66 9e-09 ref|XP_013441663.1| pentatricopeptide (PPR) repeat protein [Medi... 66 1e-08 gb|KRH09084.1| hypothetical protein GLYMA_16G195000 [Glycine max] 65 2e-08 gb|KHN31509.1| Pentatricopeptide repeat-containing protein [Glyc... 65 2e-08 ref|XP_006599607.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_013443428.1| pentatricopeptide (PPR) repeat protein [Medi... 64 3e-08 ref|XP_006587837.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_006587836.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_003591732.2| pentatricopeptide (PPR) repeat protein [Medi... 64 6e-08 ref|XP_003619304.2| pentatricopeptide (PPR) repeat protein [Medi... 64 6e-08 ref|XP_003594869.1| pentatricopeptide (PPR) repeat protein [Medi... 64 6e-08 ref|XP_013442433.1| pentatricopeptide (PPR) repeat protein [Medi... 63 8e-08 gb|KHN43628.1| Pentatricopeptide repeat-containing protein [Glyc... 63 1e-07 ref|XP_006599616.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_013459562.1| pentatricopeptide (PPR) repeat protein [Medi... 62 1e-07 ref|XP_003619749.2| pentatricopeptide (PPR) repeat protein [Medi... 62 1e-07 ref|XP_013443423.1| pentatricopeptide (PPR) repeat protein [Medi... 62 1e-07 >ref|XP_013452082.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382180|gb|KEH26110.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 456 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+IRALF+ DENDKAEKLLREMIARGLL Sbjct: 421 IPDAVTYETIIRALFKNDENDKAEKLLREMIARGLL 456 >ref|XP_013443362.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657371389|gb|KEH17387.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 554 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+IRA F KDEN+KAEKLLREMIARGLL Sbjct: 515 IPDAVTYETIIRAFFHKDENEKAEKLLREMIARGLL 550 >ref|XP_003621397.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355496412|gb|AES77615.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 550 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+IRALF KDEN+KAEKLLREMI RGLL Sbjct: 511 IPDAVTYETIIRALFRKDENEKAEKLLREMIIRGLL 546 >ref|XP_003599547.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657392391|gb|AES69798.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 555 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+I+ALF KDEN+KAEKLLREMIARGLL Sbjct: 520 IPDAVTYETLIQALFHKDENEKAEKLLREMIARGLL 555 >ref|XP_013441663.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657369056|gb|KEH15688.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 412 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPD VTYET+IRALF+ DEND+AEKLLREMIARGLL Sbjct: 377 IPDVVTYETIIRALFKNDENDRAEKLLREMIARGLL 412 >gb|KRH09084.1| hypothetical protein GLYMA_16G195000 [Glycine max] Length = 511 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL*E 186 +PDAVT++ +IRALFEKDENDKAEK+LREMIARGLL E Sbjct: 474 MPDAVTFDIIIRALFEKDENDKAEKILREMIARGLLKE 511 >gb|KHN31509.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 511 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL*E 186 +PDAVT++ +IRALFEKDENDKAEK+LREMIARGLL E Sbjct: 474 MPDAVTFDIIIRALFEKDENDKAEKILREMIARGLLKE 511 >ref|XP_006599607.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 559 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL*E 186 +PDAVT++ +IRALFEKDENDKAEK+LREMIARGLL E Sbjct: 522 MPDAVTFDIIIRALFEKDENDKAEKILREMIARGLLKE 559 >ref|XP_013443428.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657371460|gb|KEH17453.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 452 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTY T+IRALF KDEN++AEKLLREMIARGLL Sbjct: 417 IPDAVTYVTIIRALFHKDENEQAEKLLREMIARGLL 452 >ref|XP_006587837.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X2 [Glycine max] gi|947091735|gb|KRH40400.1| hypothetical protein GLYMA_09G256600 [Glycine max] Length = 577 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVT+E +IR+LFEKDENDKAEKLL EMIA+GLL Sbjct: 517 IPDAVTFEIIIRSLFEKDENDKAEKLLHEMIAKGLL 552 >ref|XP_006587836.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X1 [Glycine max] Length = 578 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVT+E +IR+LFEKDENDKAEKLL EMIA+GLL Sbjct: 517 IPDAVTFEIIIRSLFEKDENDKAEKLLHEMIAKGLL 552 >ref|XP_003591732.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657404773|gb|AES61983.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 348 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL*E 186 IPDAVTYET IRALF KDEN+KAEKL R+MIARGLL E Sbjct: 311 IPDAVTYETNIRALFHKDENEKAEKLFRKMIARGLLKE 348 >ref|XP_003619304.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382260|gb|AES75522.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 567 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPD VTY+T+I ALFEKDENDKAEKL+RE+I RGLL Sbjct: 532 IPDVVTYQTIIHALFEKDENDKAEKLVRELIVRGLL 567 >ref|XP_003594869.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|355483917|gb|AES65120.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 545 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IP+A+TYE +I +LFEKDENDKAEKLLREMIARGLL Sbjct: 510 IPNAITYEILIHSLFEKDENDKAEKLLREMIARGLL 545 >ref|XP_013442433.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657370302|gb|KEH16458.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 524 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 296 PDAVTYETVIRALFEKDENDKAEKLLREMIARGLL*E 186 PD VTYET+IRALF+ DEN KAEKLLREMIARGLL E Sbjct: 483 PDVVTYETIIRALFKNDENHKAEKLLREMIARGLLEE 519 >gb|KHN43628.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 472 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IP AVT+E +I ALFEKDENDKAEKLLR+MIARGLL Sbjct: 437 IPSAVTFEIIINALFEKDENDKAEKLLRQMIARGLL 472 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGL 195 IP+AVT++ +I ALF+KDENDKAEKLLR+MIARGL Sbjct: 285 IPNAVTFDIIIIALFKKDENDKAEKLLRQMIARGL 319 >ref|XP_006599616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] gi|947059691|gb|KRH09097.1| hypothetical protein GLYMA_16G195900 [Glycine max] Length = 583 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 +PDA+T++T+I ALFEKDENDKAEK LREMIARGLL Sbjct: 546 MPDAITFKTIICALFEKDENDKAEKFLREMIARGLL 581 >ref|XP_013459562.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657392684|gb|KEH33593.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 540 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+I+ALF KDEN+KA+KLLREM+ +GLL Sbjct: 505 IPDAVTYETIIQALFHKDENEKAQKLLREMVIKGLL 540 >ref|XP_003619749.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657382782|gb|AES75967.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 557 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDA+TYE +I +LF+KDENDKAEKLLREMI RGLL Sbjct: 522 IPDAITYEIIICSLFDKDENDKAEKLLREMITRGLL 557 >ref|XP_013443423.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|657371455|gb|KEH17448.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 548 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 299 IPDAVTYETVIRALFEKDENDKAEKLLREMIARGLL 192 IPDAVTYET+I +LF KDEN+KAEKLLREM+ RGLL Sbjct: 513 IPDAVTYETIIHSLFYKDENEKAEKLLREMLGRGLL 548