BLASTX nr result
ID: Wisteria21_contig00023766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00023766 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH02023.1| hypothetical protein GLYMA_17G010600 [Glycine max... 57 5e-06 ref|XP_006584086.1| PREDICTED: uncharacterized protein LOC100797... 57 5e-06 ref|XP_012573450.1| PREDICTED: lysine-specific demethylase JMJ25... 56 9e-06 >gb|KRH02023.1| hypothetical protein GLYMA_17G010600 [Glycine max] gi|947052571|gb|KRH02024.1| hypothetical protein GLYMA_17G010600 [Glycine max] gi|947052572|gb|KRH02025.1| hypothetical protein GLYMA_17G010600 [Glycine max] Length = 876 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 362 AREDKLEIKKMIVYAVDQAVKDLKALVKCS 273 AREDKLEIKKMIVYAVDQAVKDLK L+KCS Sbjct: 847 AREDKLEIKKMIVYAVDQAVKDLKDLLKCS 876 >ref|XP_006584086.1| PREDICTED: uncharacterized protein LOC100797860 [Glycine max] gi|734410989|gb|KHN35715.1| Lysine-specific demethylase 3B [Glycine soja] gi|947102644|gb|KRH51136.1| hypothetical protein GLYMA_07G263200 [Glycine max] Length = 889 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 362 AREDKLEIKKMIVYAVDQAVKDLKALVKCS 273 AREDKLEIKKMIVYAVDQAVKDLK L+KCS Sbjct: 860 AREDKLEIKKMIVYAVDQAVKDLKDLLKCS 889 >ref|XP_012573450.1| PREDICTED: lysine-specific demethylase JMJ25 [Cicer arietinum] Length = 893 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 362 AREDKLEIKKMIVYAVDQAVKDLKALVKCS 273 AREDKLEIKKMIVYAVDQAVKDLKAL+ C+ Sbjct: 864 AREDKLEIKKMIVYAVDQAVKDLKALLNCA 893