BLASTX nr result
ID: Wisteria21_contig00023349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00023349 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM53948.1| hypothetical protein LR48_Vigan09g260700 [Vigna a... 57 4e-06 >gb|KOM53948.1| hypothetical protein LR48_Vigan09g260700 [Vigna angularis] Length = 117 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 356 MASYSRCFVLAFFIAISFSSMDISLAARHLLQ 261 MASYS CF+ AFFIA+SFSSMDI LAARHLLQ Sbjct: 1 MASYSSCFIFAFFIAMSFSSMDIGLAARHLLQ 32